SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296749|ref|YP_005046940.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296749|ref|YP_005046940.1|
Domain Number 1 Region: 472-794
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.48e-113
Family beta-glycanases 0.00000000255
Further Details:      
 
Domain Number 2 Region: 29-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-79
Family Xylanase/endoglucanase 11/12 0.000000249
Further Details:      
 
Domain Number 3 Region: 246-368
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.39e-30
Family Family 6 carbohydrate binding module, CBM6 0.00011
Further Details:      
 
Domain Number 4 Region: 384-452
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.63e-16
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296749|ref|YP_005046940.1|
Sequence length 795
Comment beta-1,4-xylanase [Clostridium clariflavum DSM 19732]
Sequence
MTKKLKAFFSTLMCCTFLFTLLPANVQAMTLTNNATGTYQGYDYEYWKDRGNGTMTLTGG
GTFTCSWNNINNILFRTGKKLGSQKTYQEYGNIYIEYACDYRPNGNSYLSVYGWTQGPLV
EYYIIESYGTWKPPGSNQVKGYVNADGGTYEIYQTTRYNAPSIEGDKTFDQYWSVRTQKR
TSGTISVHEHFKQWEARGMRMGRLYEVSMVVEGYQSSGQANMTKMDLIIGGQPSTTSAPA
TSKPVTEKNAFQKIEAEDYDELVGSEARSIGMGIGYINNGDYAAYKSVNFGNGASSFKAY
VANGNNSNTTIQLRLGGPNGTLIGSLSVPYTGGWDTYEEMTANVSGASGTKDLYLCFSGP
VNVDWFSFGTGSPVPTNSGNPGSRKYGDLDLDGQVTAIDLATFKSHLLGMSTLTGEALAN
ADVSGDGDVNSIDMAIIKQYLLGMISKFPAENNTPPSTPTPVKTPPPSPQGTALYQLAAA
KGKYFGACINSPWFNNQTNSTYNNILRTEFGMVVAENEMKFDALEPSQNNFNWSKADKMM
DFARSNNMKVRGHTLVWHSQNPGWVTSGRWNRDSLISVMNNHINKVLGRYKGQILEWDVV
NEVIDDGNGWGLRNNSVWKSNIGNDFVEIAFRTARQADPDALLYYNDYNIEDLGGKANAA
YNLVKSLKEKGVPIDGIGFQSHFISGMSDQTFRDIDTNVKRYAALGVKVSFTEIDIRIPD
NANQYQAFQTQANEYRKLMEICLNNDNVTTFVLWGFTDQHTWVPQVFPGYGRPLIYDNNY
NPKPAYNALKEILMQ
Download sequence
Identical sequences G8LZS6
gi|374296749|ref|YP_005046940.1| WP_014255584.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]