SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296755|ref|YP_005046946.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296755|ref|YP_005046946.1|
Domain Number 1 Region: 38-280
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.07e-44
Family Carboxylesterase 0.00000248
Further Details:      
 
Domain Number 2 Region: 302-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.26e-34
Family Family 6 carbohydrate binding module, CBM6 0.0000342
Further Details:      
 
Domain Number 3 Region: 432-495
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000294
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296755|ref|YP_005046946.1|
Sequence length 499
Comment enterochelin esterase-like enzyme [Clostridium clariflavum DSM 19732]
Sequence
MQKRIVSLVLALACFFTLAKATTVTTSAAPPSGFDQYRSNIPHGKVEEITYYSTTTKTNR
KATVYTPPGYTTSQKYNVLYLLHGIGGDHQEWLNGGSPQNILDNLYAENKIAPMIVVMPN
GRAMADDRPIGDIYSPEKQAAFNNFQYDLINDLIPYIESKYSVAKDRENRAIAGLSMGGG
QALNFGLKYMDYFAYTGGFSPAPNTQSPSALVSNPSLIREKMKVIYISCGEQDSLFSIAK
GVHDYMTQVNVPHVWYQAPGNHDFVFWKDSLYQYVQLIFKNTTTPTATPTIPTNTPVPTI
KSAFDKIEAENFDSKNARELSIIDTVNGGKGIGYINNGDYAVYKSVDFKNGANSFKALVA
SSLTSTVELRLNSPTGTLIGKLSISATGGWNNYEEQTCTISNVTGVNDLYLVFSGPVNID
WFKFDGGTNTTIGLGDLDGDGYVTSVDLALLKRHLLGMGYLTGESLAKADVNRDGDVNSL
DFAYLKAAILGIIVDSPDL
Download sequence
Identical sequences G8LZT2
gi|374296755|ref|YP_005046946.1| WP_014255590.1.34793 WP_014255590.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]