SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296801|ref|YP_005046992.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296801|ref|YP_005046992.1|
Domain Number 1 Region: 43-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000536
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296801|ref|YP_005046992.1|
Sequence length 158
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MNNELRNIISRVRQEIDTHPDGPTIGELNEGNSDATTNNIYLKEYIDFLKVCNGARCGPI
DIISFEDIERSQHLILELPGFENWLYIGQILYDILVINKDDGNVWIYIETPPGFQKGNCL
GRFDEFIKDYVFGKKFIDITPSGINSKWYQLLEKLQIV
Download sequence
Identical sequences G8LZX8
WP_014255635.1.34793 gi|374296801|ref|YP_005046992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]