SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296923|ref|YP_005047114.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374296923|ref|YP_005047114.1|
Domain Number - Region: 167-265
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0308
Family alpha-L-arabinanase-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296923|ref|YP_005047114.1|
Sequence length 437
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MDCKNRIDDIWESALKREVQKIDVPEDLLDKIKSEMRNEKNINRTFMNNIKEFFCPFQLN
TLRVILTAVVCVTFLAVQFLIFSENARVFALDSINNALTLVYRIVGYENGEYKVDKVPLE
EPEWFYRDSVFYADKYIEQIVGFPVCFPEALSDGCNAFYGRNIYAVEDQNKNKVYMVSTI
YSNNTGSNIIVLETSKDKENYFFGNIYNTKSYKVGNKEVIWGECPHLIFPNNDPRQMPID
LDISHVLLWENNGVYYRLWSANNDISVDKGLKLVEEIINNKCPENTKFKHTGVLYGKNDI
SNNDVMNMVGHPVRIPDELSEGFSLEYKTVSTIMENGQTGYEVCGYYKKDNRHLKITMVK
IDENYSVLKNLPSTEVLNIGDVECYWYEQNASELEGKSDNFFEFKIDGVNYLLSILDGCF
ESKEEAISIAKSILEFQ
Download sequence
Identical sequences G8M1H5
WP_014255751.1.34793 WP_014255751.1.85326 gi|374296923|ref|YP_005047114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]