SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297002|ref|YP_005047193.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297002|ref|YP_005047193.1|
Domain Number 1 Region: 80-140
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000657
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297002|ref|YP_005047193.1|
Sequence length 144
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MVSFNKVIEKVKEIIIKIQCSNDLQQIKWQEGKSRGHILGKFTMSNNFAKIYTKIYTSKV
KTSNTNTTKQEVTISMKSKVIKGDINGDGVFNSIDLALMKMYLTGSIKFTEEQFEAADVD
NSGEVNSIDYAIMKQVLLGYRPGF
Download sequence
Identical sequences G8M2B0
gi|374297002|ref|YP_005047193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]