SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297032|ref|YP_005047223.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297032|ref|YP_005047223.1|
Domain Number 1 Region: 32-190
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.2e-52
Family Cellulose-binding domain family III 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297032|ref|YP_005047223.1|
Sequence length 621
Comment putative S-layer protein [Clostridium clariflavum DSM 19732]
Sequence
MKAKKGLYILLTALLAFSCMFSNFAFADTAPSIKIELDKTSAAVGDIIKASIVVNNVKGF
AGYQVNIKYDPTVLEAINLDTGAAFTNTTVPQSGTILNNSEYGVLPIASHNVSQGILNFS
KAYTNLNSYKASGSAETTGTVAVIGFKVRRAEETKIEFAQTSTMPTAVSGVLLFDWDGNK
LTSGYSIINPPAINATSNTNIPTPIVVTTPLEITTSTPTPTSSGSGKKGEIEPKVVNNDN
TRVIYKFEQKDLETALQDLTPDSKGVKKVDLTLAGVKGATAYTQEFPNQALLSNVLSYKI
NMITAYATLELPANMLNTDALASKVRSASKVAISVERDYSSGLSSDIQGKIDNRPMIKLS
LNVNDVPTDWVNLESPVKVYIPYALTQEEKSSIEHIVVLRIDNNGNAIPVTNGRYDEKTK
SVTFTTSQFGRFAVAYVHRTFNDLESHAWAKHQIEVLASKGVINGTSETTFAPQAYITRA
DFMVLLVKALDLNAVVDSNFDDVPADAYYYNQIGIAKKLGITTGVGDNKYNPKAQITRQD
MMVLITRALMVTGKINSEGTADVIANYTDKGDIAPYAVTGVATLVKEGIVLGSNNMINPR
GNASRAELAAIVYKIYNNYNN
Download sequence
Identical sequences G8M2Z0
gi|374297032|ref|YP_005047223.1| WP_014255850.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]