SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297033|ref|YP_005047224.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297033|ref|YP_005047224.1|
Domain Number 1 Region: 44-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.69e-35
Family beta-glycanases 0.0069
Further Details:      
 
Domain Number 2 Region: 466-593
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.38e-31
Family Family 6 carbohydrate binding module, CBM6 0.00031
Further Details:      
 
Domain Number 3 Region: 602-673
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.55e-17
Family Type I dockerin domain 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|374297033|ref|YP_005047224.1|
Domain Number - Region: 350-441
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000111
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297033|ref|YP_005047224.1|
Sequence length 673
Comment O-glycosyl hydrolase [Clostridium clariflavum DSM 19732]
Sequence
MLKKRKLVLSVVLSMVLTLVNFPKTNAASYTASVDVNTTYQTLEGFGAAIAWYNDYLTTH
PNKNDLYRILFYDSGLDILRLRNQYRNSNNFGYDDMEIVKYGKIMNPNLKVLLSSWSPPS
DLKRNGVMNGGTLAKENGSFVYEKFADYWYNSLVAYRAKGIIPDYISIQNEPEYESGDWE
TCIFRETETSEYPSYAKALDAVYEKIKDLPDMPKILGVESAGIMNNTVQNYARYMDLSKV
YGIAHHLYNGGDPYNPDSFNDIFRSLARDFADKPLFMTEYDYGTPFTTAELIHNSLVVEG
VSGYFYWDLIWENSQRPLVAIEVPRNPEQWTTKEGYIISDFYYIMQQFAKFTDPGYKRVD
ASVSSNDIKVSAFVSPDKSKLTMIFINKGYSEHSVALDLKGYSSNKSIIYRTLPEGNERF
KKVGSLFGNTVTLPARSVVTVALGVDDEEQIPPQLPTPTPKPESRSAYDIIQAEDYNEMY
GIQCETIADDGNKNVAYIENGDYILFKGVDFGTGATGFEASVASAESGGAIEIRLDELYG
TTVVKIPVSGTGDWHNYVTVKADIPEIKGKHDLYLVFTGGGGYLFNIDWFVFTGGTVENP
VPEVIYGDVNGDGDFNSIDYGYLKMYLLGQIKEFPSKDGMIAADVNGDGTVNSIDYAYMK
MRLLGQISKFPVE
Download sequence
Identical sequences G8M2Z1
gi|374297033|ref|YP_005047224.1| WP_014255851.1.34793 WP_014255851.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]