SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297111|ref|YP_005047302.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297111|ref|YP_005047302.1|
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-20
Family N-utilization substance G protein NusG, N-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 121-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000431
Family N-utilization substance G protein NusG, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297111|ref|YP_005047302.1|
Sequence length 179
Comment transcription antiterminator [Clostridium clariflavum DSM 19732]
Sequence
MMYWYVLFVKAGRERKVEQYLRKQLNPDISVPFIPLQEILFRRSGIVKREIKFLFPGYVF
IESVLSDLQFIQKINPVINRCSDIISLLKYSNTEISMKESEKNMLINLCDSEYCIGASYG
IIEGDKIHIIDGPLKGLESIVKKVNRHKREALIEMEIMGEVRLVTVALEIVEKVAYSYC
Download sequence
Identical sequences G8LSM6
gi|374297111|ref|YP_005047302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]