SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297296|ref|YP_005047487.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297296|ref|YP_005047487.1|
Domain Number 1 Region: 2395-2920
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3e-106
Family Glycosyltransferase family 36 C-terminal domain 0.000000351
Further Details:      
 
Domain Number 2 Region: 2128-2389
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-76
Family Glycosyltransferase family 36 N-terminal domain 0.0000474
Further Details:      
 
Domain Number 3 Region: 1632-1899
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-70
Family Glycosyltransferase family 36 N-terminal domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297296|ref|YP_005047487.1|
Sequence length 2921
Comment cellobiose phosphorylase [Clostridium clariflavum DSM 19732]
Sequence
MREYIILYLFAALIIFVFASCLILLKSKEEKIKIRDALLNADELEAYAIEIAYDHAVSKK
LKFFNWPVPRLNENYRYILSVYKSLNEDIKREIGTTPAAEWLLDNFYIIEEQVKSVRKDL
SKEYYSKLPMLSSGPLKGYARIYTVALELVSHTDGRIDEKVLVNYIKAYQSHKTLASREL
WALPIMLKLALIENIRYICQTIEKTQRQRRKVEEIISAVKSENGIDADKLIHAIKNEIKG
EYKINSAFIEHLAYRLRKMGRAYAHVLRQIDDILGMNGTSIDYITHKEHSEQTARKGSIG
NCIISLKYISSCDWVEIFEALSKVEEILRTDPDGTYNLMDLSSKNYYRKKIEELALEFDV
SEKHIANKVVELAKRAMENREDLNEISFRKKIHVGYYIIDEGVKQLREEIGPDKTFNKAF
SEFVRKRPLTLYIGSVSIITVLISLLIARYVFNSAHKFNGALALLSILVVLIPVSDVSVN
FINWILNHLFKPSFFPRIELRDGIPEEYSTMVVIPALLPDEKRAKELIDNLEVYYLSNRE
KNLYFALAGDYKDSDSKDLDGDSKIITTALERIKELNKKYSKDGKDIFFFFHRHRQFNDR
QKKWMGWERKRGALLEFNDMLLGSKKTSYSITSTDISLLPKVKYVITLDADTVLPLGTAK
KLIGTMAHPLNLPEIDEKRGIVVKGYGLMQPRIGFDIESVNKSLFSRIFAGEEGIDPYAC
AVSDVYQDLFGEGIFTGKGIYDIEVFQKLLGDAIPENTVLSHDLLEGSYIRTGLVSDLEL
IDGYPSKYNSYAMRLHRWVRGDWQLLPWIGRKISNRFGKEIANPITAVSKWKIIDNLRRS
LVAPFLMLIAFFGFSIFPGNTLAWTGIILLFMYFPFILSGFDYLVYKPVRVMLSRRYIPV
ICGLKAVFLQITLQFVFLPYQAYLMANAIAISLVRVFITKRNMLEWVTALDTEKTLKNTL
RSYIAKMKIGVIEAVIVFALALLLKPQWAVWAFAVCLVWFVSPYIAFRVSQEEVKSIEPL
DSNDLLELRVTARKTWRYYEEFVNSKNNYLAPDNYQEEPPNGIAYRTSPTNIGLGLLATL
SARDFGYIGTEEMYRIVKRTVTTIEKMDKWNGHLYNWYDTRTLDTLKPRYISTVDSGNFV
CYLITLKEGFIEYLNRPLIERVFVDGIKDTVILAEREAKQNLYETDELESFAASFDKAGN
FDLRLWIGALDKLGGKYGNNDKKVNVWARKVEHMVSLFKSELNNYYSWSHLLFEMPEEWE
KRAYKSDIEKPMETILNLFRLNVPLVKLPEHYKKIKFEIDKLNKTIAKSRENHLVNIKNW
LDRLKHELEKSIQNAEQLISNYNYLVDRIDKISCETEFIHLYDKKRQLFSIGYNIEEGSL
TNSYYDLLASEARQTSFIAIARGEVDAQHWFKLGRTLTRIDRYKGMVSWSGTMFEYFMPL
LIMKSVKNTLLDETYAFVLRSQKKYGKQRNVPWGTSESGFYSFDIKLDYQYKAFGVPWLG
LKRGLAEDMVVAPYATMLALPVDPHDSVKNLKRLAAEGANGPYGYYEAIDYTPERLPIGS
KYAIVKSYMAHHQGMSLVALNNYINGNVMQQRFHNDPVVNAAKLLLQEKVPANIIFTKEN
KEKILPFTDVTYDVEDSLREYSHPDYELPKAHILSNGSYSVMVTDRGTGYSRNSMIDVTR
WREDITLDNYGIFFYIRNTNTNTIWSSTYSPADKRPDMYNVVFTSGVAKYHRRDGDIDTV
TEVVVSSNDNAEIRRLTFTNHGNETCVLEVSSYYELVLAQHGTDVAHPAFSNLFIRTEFI
PELNCLIANRRPRSENDKPVWSLNLMTIEGEAVGGLQYETDRFKFIGRGRNVTNPQVIEE
RKPLTNTVGPVLDPIMSMRCMLKIEPGKTAKVNLVVAVGENRGAVLDLAAKYINPEIIPE
EFNLAATRSRVEARYLNLKASEIEFYQELLSHILFISPAQKLRMECIINNTKGQSGLWAY
GISGDIPIVLLTLEKTDDIDIVYELLKAHEYWKYKNLKVDLVILNEEENSYTNPLQGLLF
DILSSSHAHDMINKPGGVFVIKKSNLPEEDINLICAAARVVLKGSAGDLREQLYIKNENH
LPQLKEYKGTIKKYQNKYAENSDLQFFNGIGGFKNDGKEYEIVLKSGITTPLPWTNVISN
RKFGFIVTESGGGYTWHENSRENKLTPWSNDPVSDTPGEIIYVTDDDTGEVWNITALPIR
ENETYSAIHGFGYSIFRNSGHGFEQELTQFVPVKDNVKLSLVRLKNTSDSSRKLGLYYYI
RPVLGVSDQFTASHISTERHKTGAILIRNTYNDEFPGRIAYVDTSIKDRTFTCDRKEFLA
GGALTNPPGLRRQKLSETVGAGLDPCVALGIFLEFDPGEEKEIVFALGEGSSITEVEEMV
NKYRKVEEVKKALGEAKNFWKEKLEILQVSTPDKAIDYMLNGWLMYQVLSCRMWTRSAFY
QSGGAYGFRDQLQDCLSVAHVMPEITKEQILLHSKHQFVEGDVQHWWHEEKYKGTRTRFS
DDLLWLPFVTAEYIRITGDSDILKIETPFLEDEPLKDFEDESYRIPRVSDEKSTLYDHCI
RAIERSLKFGEHGIPLIGSGDWNDGMNTVGNKGKGESVWLGWFLYSILTKFVPICQSFGE
EERAERYSNIAMEIAKAIEENAWDGNWYRRAYFDDGRPLGSIQNSECQIDSLAQSWAVIS
GAGNKDRINMAMNALENYLVKRDEGLIKLLTPPFDEGDLEPGYIKSYVPGVRENGGQYTH
AACWVVMAFAMLGDGDKATELFNLINPINHAKTQIEISKYKAEPYIIAADVYSVEPHTGR
GGWSWYTGAAGWMYRVGVEYILGFKKNGDRLSIDPCIPKEWKDFDIKYKYKDTQYYITIK
NPEGVNKGVKKVILDGKELEDKIIALVDDKKEHKAEVIMGK
Download sequence
Identical sequences G8LUD1
gi|374297296|ref|YP_005047487.1| WP_014256109.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]