SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297297|ref|YP_005047488.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297297|ref|YP_005047488.1|
Domain Number 1 Region: 312-753
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.53e-103
Family Cellulases catalytic domain 0.00000429
Further Details:      
 
Domain Number 2 Region: 33-225
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.59e-51
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.000000163
Further Details:      
 
Domain Number 3 Region: 200-310
Classification Level Classification E-value
Superfamily E set domains 8.4e-18
Family E-set domains of sugar-utilizing enzymes 0.0012
Further Details:      
 
Domain Number 4 Region: 760-829
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.47e-17
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297297|ref|YP_005047488.1|
Sequence length 831
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MRKGKVSLFLVVTLLASLLTPAASKAATPPEDYRKLQDIQIFLNKPVTGWSGSGAEELET
ENSTLPVDATEKYNGLPSLRLNVSKAVTSGWWISLLTLREWNTHDISQYVENGFIEFNIK
GKDGGENFIIGLRDKVYERAIGTELDVKTVINKYIDISTEWQHVKIPLRDIVTAGGGFDA
TSVTCLFLEKAHVNPFTVWINDLKITSPDNEKSFTAIKVNQVGFLPDAEKYALVTGFMEE
LQASEGTAFEVRSAKDDSVVYEGKLTLVTECEPIDSGEKILKADFSGLTEEGEYYICVSG
IEEKSYKFKIGSNLYEGLLYDALRYFYYQRQGIDLVEPYAQGFARKDLTPMDNAVRSQLP
TVTKTFELTKGWYDAGDFGKYVNAGATALSDLFWTYEMFTENMKNFEVNIPESGDSIPDI
LDEARWELEWMLKMQDPVSGGFYPRVQSDNDDNITMRILKNANGCTTDDSACAAAVLAHA
YLLYKDIDSEFAEKCLEAAEVAWKFLEKNPKNIVSPSGPYNVTNDRADRLWAAASLYRAT
GDEVYNTYFLNNYKSFEGNFTNSYAYAHTWGNMWLTAYICYMKADNVDESAAAWIKTAFG
KWLNLILNRYENNPWNNTIVPGNYYWGINMQVMNVPMDAIIVSQFVDSVDISKVREMAFG
SLNWLLGTNPMSISYVSGHGENSVKRVYSIIYNNDGKPGIPNGYMPGGPNAYEGAGLSRF
AAKCYTTSSGDWVANEHTVYWNSALVFMAAYANSKQTVGFILGDVDGNGKIDSIDFATLK
QYMLGMIKTLPSPYEEIAADVDGNGTINVIDLAYLKKYLLGMISKFPAEVN
Download sequence
Identical sequences G8LUD2
WP_014256110.1.34793 gi|374297297|ref|YP_005047488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]