SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297363|ref|YP_005047554.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297363|ref|YP_005047554.1|
Domain Number 1 Region: 31-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.41e-79
Family Xylanase/endoglucanase 11/12 0.000000121
Further Details:      
 
Domain Number 2 Region: 410-524
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.16e-54
Family Family 36 carbohydrate binding module, CBM36 0.0000962
Further Details:      
 
Domain Number 3 Region: 256-382
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-30
Family Family 6 carbohydrate binding module, CBM6 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297363|ref|YP_005047554.1|
Sequence length 525
Comment CBM6-containing protein,glycosyl hydrolase family 11 [Clostridium clariflavum DSM 19732]
Sequence
MKQRSKLIFSTVVCLIFVLSLFPASVNAAITLTSNATGNYDGYDYEYWKDYGNGTMTLTG
GGSFTCSWSNINNILFRTGKKLGSTQTYQQYGNIIIDYACNYQPNGNSYLSVYGWTQNPL
VEYYIIESYGTWKPPGSNSPKGYINVDGGTYEIYETTRYNQPSIEGDKTFQQYWSVRTVK
RTSGTISVHEHFKAWEARGMRMGKLYEVSMVVEGYQSSGRAEMTKMNITIGGQGSGNTGG
NNGGNNGNPGPAPAEQSAFTALEAEKYNSTNSSTVQIIGTGNGGSGVGYIENGNYLEFKN
VNFGSGAASFKARVAYGGNSTTTIQLRLGSSTGTLIGSLNVTSTGGWDSYKELTTTVSGA
SGVKDLYLCFNGPVNIDSFVFGTADNNNDKPVDNKPVDNPGNNNSGPVIIQCENMIKSGQ
YTGNISSPFSGVALYANNDSVKFTHNFTSSTSTFSLRGCSNNQNMARVDLRIGGQYKGTF
YYGGSYPAVYTIQNVSHGTGNQTVELIVTSDNGTWDAYLDYLQIN
Download sequence
Identical sequences G8LV53
WP_014256173.1.34793 WP_014256173.1.85326 gi|374297363|ref|YP_005047554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]