SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297457|ref|YP_005047648.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297457|ref|YP_005047648.1|
Domain Number 1 Region: 89-157
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.55e-16
Family Type I dockerin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297457|ref|YP_005047648.1|
Sequence length 182
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MADVIYESFEELPMDGQVLTIEDENTTSISEELTGNEKDNSEEITDTSVQDSVYTPKEIQ
NEFIDELPVEPIIPSYIKMFSEFPEDKPLIGDVDGNGDVNSIDYAFMKMYLLGIINDFNV
EDDLWASDVNGDGVFNSIDYAFMKLFLLGRIKEFPKQNLIETPTPVPTEMTIGTPTPTEN
VR
Download sequence
Identical sequences G8LW77
gi|374297457|ref|YP_005047648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]