SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297501|ref|YP_005047692.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297501|ref|YP_005047692.1|
Domain Number 1 Region: 49-478
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.42e-143
Family Cellulases catalytic domain 0.00000000125
Further Details:      
 
Domain Number 2 Region: 500-657
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.78e-36
Family Cellulose-binding domain family III 0.00028
Further Details:      
 
Domain Number 3 Region: 678-744
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000536
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297501|ref|YP_005047692.1|
Sequence length 747
Comment thioredoxin domain-containing protein [Clostridium clariflavum DSM 19732]
Sequence
MKKIKAKAIFRKLSKVTAVVLIASMMSSLLVPEQKIQAASSPRAGGSYYNYGEALQKALL
FYKANRLGDLPDDYILPYRADAAMTDGQDVGLDLTGGWADAGDGIKFTHTISYAAAQLGW
DVYEYRDAFKKAGQLDVILDEIKWGTDFLIKAHPEPEVLYYMCGYNESDHGCWVAHEMLD
YMTDRKSFVLNPSTPGSDVAGMTAAALAIASIIFEETDPQYAQECLKHAKEIFAFGDKYR
GRNPLDVLYPSGSYLDDLAWGAIWLYIKTNDSTYLDKAKSCLPPTALGGGHTHCWDDVSY
GAALKIAQVTHDDAYVAMVEKNLDYWLPGGGITYTPGGLAWLSPWGSLRYATTAAFLAFV
WADDKTVGTASKKEAYREFAERQINYALGDNPRKGSYVVGFGENAPEHPHHRTSHGSWTS
MLDVPGFHRNILYGALVGGPNSDDGWVDDITDYRLNEVAIDYNAGFVGSLAKMYDMYGGE
PLKDWPKPEDFRAKEDNFPEYFCRAWIIYEGYGSMNLMFQVNNRSAHPPTMKDKLSVRYF
MDLTELFEAGKGLDDVSITLGEHQGAKLIGLQHYKDNIYYFTLDFTGTRIMPTEWEMCEK
DATVTIKYKDEKIGSNENDWSYQNLRRDPDYDATSFAGLTPYIPVYDNGVLIFGEEPGGV
TPAPSTKPTPTPTPTNPNIVYGDLDGNKEVNSVDYALLKGVLLGIIRTDVDMAAADLNLD
GDVNSIDYALLKMYLLGQIKELPYRLP
Download sequence
Identical sequences G8LWC1
gi|374297501|ref|YP_005047692.1| WP_014256301.1.34793 WP_014256301.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]