SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297540|ref|YP_005047731.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297540|ref|YP_005047731.1|
Domain Number 1 Region: 53-187
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.4e-27
Family Cellulose-binding domain family III 0.0014
Further Details:      
 
Domain Number 2 Region: 196-335
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.41e-25
Family Cellulose-binding domain family III 0.00053
Further Details:      
 
Domain Number 3 Region: 339-478
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.23e-24
Family Cellulose-binding domain family III 0.0017
Further Details:      
 
Domain Number 4 Region: 697-843
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.66e-18
Family Cellulose-binding domain family III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297540|ref|YP_005047731.1|
Sequence length 1370
Comment putative S-layer protein [Clostridium clariflavum DSM 19732]
Sequence
MYHSTYSKKEGMHMEKRVDKSLFSLKNIACLLLTMCIILSNSSLPFVQAAGQLQIDIGRV
SGEPGSIVTVPVTFSNVPATGIYALSLNLNFDSTKISVVSVEPGSLVEDPDDFALFTNNE
HGFTSMSFMAPADRSRIVDKDGVFAAIKFKISEANPVGEVYDISVNYSRTSFYSTGTEEI
KNVLYNDGAILVGSNLSAEIGSISGKPGDTVNVPIKFYNVPASGIYTLSFRVGYDKNKLS
VVGVEPGALIEDPRDMNYYTMTSSGLTTITFEAPADETRKIRNDGVFAILKFKISDTALD
GEVYKISTVLANTFFYSTGVNEIKNVVYNDGTIRIGTDMKVGIGSAAAGAGSTISVPITF
DNVPQIGIYALSLRVNYDPEKINVEGIYSGELIEDSNDFNSYYNNIHGFASMTFEAPADE
SRRINKNGVFAIVNFKVNDSAKAGEVYQITTNSAYTSFYYSGTDEIKNVIYSNGKIEVTN
IVTPTNTPTFTPIVTITPTKTPIPTPTETVTPTKTPTTTPTVTATPTKTPTTTPTVTATP
TKTPTTTPTVTTTPTKTPTPTPTVTATPTKTPTPTPTVTATPTKTPTPTPTVTATPTKTP
TPTPTVTTTPTKTPTPTPTVTTTPTKTPTPTPTVTATPTKTPTPTPTVTATPTKTPTPTP
TVTATTTNTPTPTPTVTTTPTKTPTPTPTLWPIGTPMNVKVGSVNAEKGKDSQVEVPVYF
ENVPEVGIYVCSLFIKFDETKLKVVEVKPQELIEDKSDFASHFDNTNINRFNSGFVSMSF
MGPADDSRRINKDGVIARIVFELLDPKVGDVYWLLNYKDSSGVYAYGAKEITNVKYIDGK
ITILEAPTPTVTATPTKTPTPTPTVTTTPTKTPTPTVTATPTKTPTPTPTVTATPTKTPT
PTPTVTATPTKTPTPTPTVTTTPTKTPTPTPTVTTTPTKTPTPTPTVTATPTKTPTPTPT
VTATPTKTPTPTPTVTATPTKTPTPTPTVTATPTKIPTPTPTVTATPTKTPTPTPTVTAT
PTKTPTPTPTVTATPTKTPTPTPTVTATTTNTPTPTPTVTTTPTKTPTSTPTVTATPTVA
PTDSATPTPTPTAEPTGNTTSTPKPTSSSGGGSGGGAGGGSGGGSGAGGGSKATPTPTVT
VTPKPVTPTPVPTVIEPTPEIPGVDVPVYSHTAYLKGYPDGLFLPENNITRAEAATILAK
LSGIDTTYVNDRISYPDVKETHWALWAIKYCTDKGYFKGYPDGTFKPDQRITRAEFATIV
YHFLGIKDETIVSYKFEDVKGHWAQLYIEKLVELNCISGYPDGTFRPQASIKRCESVALL
NRALKRGPLNGASQVFPDVPETHWAFKDIAEGALDHKYIMNGDNEIIHVD
Download sequence
Identical sequences G8LWU6
gi|374297540|ref|YP_005047731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]