SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297541|ref|YP_005047732.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297541|ref|YP_005047732.1|
Domain Number 1 Region: 199-359
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.33e-55
Family Cellulose-binding domain family III 0.00000444
Further Details:      
 
Domain Number 2 Region: 567-727
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.59e-55
Family Cellulose-binding domain family III 0.00000461
Further Details:      
 
Domain Number 3 Region: 369-529
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.4e-54
Family Cellulose-binding domain family III 0.00000454
Further Details:      
 
Domain Number 4 Region: 883-1043
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.68e-53
Family Cellulose-binding domain family III 0.00000651
Further Details:      
 
Domain Number 5 Region: 30-188
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-51
Family Cellulose-binding domain family III 0.000000712
Further Details:      
 
Domain Number 6 Region: 1055-1126
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000687
Family Type I dockerin domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297541|ref|YP_005047732.1|
Sequence length 1127
Comment Cohesin domain protein [Clostridium clariflavum DSM 19732]
Sequence
MKVNRILSFLLTLMLVICSLCGNLVNAAPTSSIEIVLDKNKASVGEIVTASINIKNITDF
SGCHVNLKYDPNVLQPVTSNGVAYKNSTTPESGTILKNTDYGINLVASNKVEEGILNFSR
SYLNLKSYREDANPESTGTVAVIRFKVLKEETTSIKFEDSTSLPNGINGTLLFDWFGNRI
DSGYTVGQAQTINLNEEDSSYITINFDKNSAEVGEIIKAVVKINNIKNFSGYQVNIKYDP
EVLEAVNPDTGEVYTNSTVPTSGDLLKSEEYGPFSKAENKVTEGILNFGSLYTNLSAYRA
DGRPEETGTLAIIGFKVLQKKPTTVLFEDTEVLPNGINGTTLLNWNGDRIQSGYSVIQPE
TINFNLDDTSYITMTFDKNSAEAGEIITATLKVNKISNLSGYQVNIKYDPEVLQAVNPNT
GRAYTNSTIPTSGELFTSEDYGVLPNAAHNIEKGILNFSRSYINLKAYREDGVAEETGTI
AVIGFKVLQKKETAVLFENAASIPNAIDGTVLIDWYGNKISSGYTVIQPEKINVEIVPTA
TPTPTPTIAPTETPTPAPTETAVPTTDSYITMTFDKNSAEVGEIITATLKVNKISNLSGY
QVNIKYDPEVLQAVNPNTGRAYTNSTIPTSGELFTSEDYGVLPNAAHNIEKGILNFSRSY
INLKAYREDGVAEETGTIAVIGFKVLQKKETAVLFENAASIPNAIDGTVLIDWYGNKISS
GYTVIQPEKINAEVISTPTPTTTPTTTPTATPTATPTITPTVTPTITPTTTPTITPTVTP
TITPTTTPTITPTVTPTITPTTTPTVTPTATPTTTPTTTPTVTPTATPTTTPTTTPTVTP
TATPTTTPTTTPTVTPTITPTTTPTTTPTVTPTITPTATPIRDSYITIDLDKTEVSVGDV
IIASVRVNDIKNLSGYQVNIKYDTDVLKAVNPITKEAYTNNSLPLDGEILINDEYSIFSK
AESNVNEGILNFSKGYVNLKEYRESNKPEESGSILVIGFEVLQAKNTFIKFEDSTSMPNG
IEGTILFDWNGDRIADGYAVIQPVEITVNEAPSHKFIYGDVDGNESVRINDAVLVRDYVL
GKIDEFPYEYGMLAADVDGDGNIRINDSVLIRDFVLGKISLFPVEEQ
Download sequence
Identical sequences G8LWU7
gi|374297541|ref|YP_005047732.1| WP_014256341.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]