SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297542|ref|YP_005047733.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297542|ref|YP_005047733.1|
Domain Number 1 Region: 742-892
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.89e-57
Family Cellulose-binding domain family III 0.00000352
Further Details:      
 
Domain Number 2 Region: 921-1058
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.12e-33
Family Cellulose-binding domain family III 0.00011
Further Details:      
 
Domain Number 3 Region: 568-714
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.02e-32
Family Cellulose-binding domain family III 0.00013
Further Details:      
 
Domain Number 4 Region: 234-380
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.04e-32
Family Cellulose-binding domain family III 0.00015
Further Details:      
 
Domain Number 5 Region: 1083-1219
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.14e-32
Family Cellulose-binding domain family III 0.00011
Further Details:      
 
Domain Number 6 Region: 410-555
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.4e-32
Family Cellulose-binding domain family III 0.00014
Further Details:      
 
Domain Number 7 Region: 71-217
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.66e-32
Family Cellulose-binding domain family III 0.00012
Further Details:      
 
Domain Number 8 Region: 1244-1380
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-32
Family Cellulose-binding domain family III 0.0001
Further Details:      
 
Domain Number 9 Region: 1413-1546
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.11e-27
Family Cellulose-binding domain family III 0.00046
Further Details:      
 
Domain Number 10 Region: 1553-1642
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000000745
Family Pre-dockerin domain 0.00017
Further Details:      
 
Domain Number 11 Region: 1651-1706
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000153
Family Type I dockerin domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297542|ref|YP_005047733.1|
Sequence length 1707
Comment Cellulose binding domain-containing protein [Clostridium clariflavum DSM 19732]
Sequence
MKKVISMIVAIAMLVTMFSTMINLGTAFAAQDDSTALPAGVLGWAKYGYDNAIAQIENAD
ITALATLTSAGFTVSVESVEGKSGETITVPVKFSNVSSVSGAGITTCDLTITYDATKLEY
VSGEAGSIVTNPRVNFALNKEEDGKIKILFLDETLVSQYISEDGVFANLQFKVITSAAVS
TTVSISKSTYANRSLAPVSANVIDGIIKLNGSSTIATPTNAVAPTPTKAATVTEFTAEIG
SVEGKSGETITVPINFIKVPSNGITTCDLTITYDATKLEYVSGGAGSIVTNPSVNFSLNK
EEDGKIKILFLDETLVSQYISEDGVFANLKFKVITSAAVSTVVSISKATFADRQLKPITT
DLIDGIIKLNGGGSIATPTTVVTPTPTKVVTPTPTNVVTPTPAKTPVVTGFTAEVGSVEG
KSGETITVPINFIKVPSNGVTTCDLTITYDATKLEYVSGEAGSIVTNPSVNFAINKEDDG
IIKLLFLDETLVSQYISEDGVFANLKFKVITSAAVSTVVSISKATFADRQLKPITTGLIN
GIIKLNGGGIIETPTPVGVVTPTPVVTGFTVEVGSVEGKSGETITVPVNFIKVPSNGVTT
CDLTITYDATKLEYVSGEAGSIVTNPSVNFAINKEDDGIIKLLFLDETLVSQYISEDGVF
ANLKFKVITSAAVSTVVSISKATFADRQLKPITTGFINGIIKLNGGGIIETPTPTKVVTP
TPTIVVTPTPTIVVTPTKTPVTSNLKVEFYNTNTQAESNSIYPKFRLTNTGSSPINLADV
KLRYYFTIDGEKSQNFWCDWSPVGSSNVTGQFVKMTQATATADYYLEVSFSSAAGSLQPN
TPIEVQCRFAKTDWTNYNQANDYSFNSSATNYTTWDKVTAYLSGNLVWGIEPIASATPTP
TTPVTPTPTNIVTSTPDPNALTVAVGKVEGKAGETVTVPVTLTKVPANGITSADFAITYD
SSVLEYVSYEAGSIVKNPSVNLALNKEKDGLLKVLFLDETLINEYIAEDGIMINLKFKIN
SNAKAGTSATVAIGDKPTFADRSLKPIKLALVNGSVTVKDGTTPVTPTPTNIVTSTPDPN
ALIVAVGKVEGKAGETVTVPVTLTNVSANGVTSADFAITYDSSVLEYVSYEAGSIVKNPS
VNLALHKEKDGLLNVLFLDETLISEYIAEDGVMLNLKFKINSNAKAGTSATVAIGDKPTF
ADRSLKPIKLAVVSGSVTVKDETTPVTPTPTNIVTSTPDPNALIVAVGKVEGKAGETVTV
PVTLTNVSANGVTSADFAITYDSSVLEYVSYEAGSIVKNPSVNLALHKEKDGLLNVLFLD
ETLISEYIAEDGIMLNLKFKINSNAKAGTSATVAIGDKPTFADRSLKAIKLAVVNGSVTV
KDETVPVTPTPTDTVTNTPVPVTPTPTPDLEGFNVVIDTVNAAKGQEVIVPVQLINVPEG
GLAAADMTIIYDATKLEYVDIEAGSIVINPRINFAAHKEADGIVKILFLDESFVDQYISE
DGDFAKLIFKVIGDEGLAEIKIEKINFADRSLKPVSLESKNGGVNIGTIVEGFTVSGYIA
PDFVTTSATAPKVNAGFKVEVVGTGKSAVTDGNGYFEIKDVAAGTYTIKITKDNYLAREI
ANVQVSANKELSTATEPLLMWAGDMIINGVQDGAINLEDIMEICKSFNAVAGDDSYVEGS
DLNKDGAINLEDIMIVAKHFNKVSSDY
Download sequence
Identical sequences G8LWU8
WP_014256342.1.34793 gi|374297542|ref|YP_005047733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]