SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297588|ref|YP_005047779.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297588|ref|YP_005047779.1|
Domain Number 1 Region: 172-240
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000657
Family Type I dockerin domain 0.0024
Further Details:      
 
Domain Number 2 Region: 39-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000392
Family Type I dockerin domain 0.0025
Further Details:      
 
Domain Number 3 Region: 115-167
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000128
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297588|ref|YP_005047779.1|
Sequence length 246
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MKKLFSRRLCFLSAVVFLLSVAFFISAPFTVFADSSGSKGDINGDGVIDGADFELLRYYF
LGMRKLSESQLEQADINNDGVVDIEDLNYFPRVLPVVYDIPTPGLIWVEIPEGKGDINDD
GVVDYLDTVLFKEALLGMRKLSESQFEQADINNDGELDRNDFEAFPRIPRGTVFGDINNS
DTLDSFDLALFKAYLLGMAEIEPDPQKKYIWDANADGNINSIDYAMLKRYFLGILIELPI
QMCVEI
Download sequence
Identical sequences G8LXD7
gi|374297588|ref|YP_005047779.1| WP_014256387.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]