SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297593|ref|YP_005047784.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297593|ref|YP_005047784.1|
Domain Number 1 Region: 415-616
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.04e-82
Family Xylanase/endoglucanase 11/12 0.0000000593
Further Details:      
 
Domain Number 2 Region: 30-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-77
Family Xylanase/endoglucanase 11/12 0.000000295
Further Details:      
 
Domain Number 3 Region: 880-1068
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.7e-54
Family NodB-like polysaccharide deacetylase 0.00000333
Further Details:      
 
Domain Number 4 Region: 738-866
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.09e-31
Family Family 6 carbohydrate binding module, CBM6 0.0000373
Further Details:      
 
Domain Number 5 Region: 243-366
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-29
Family Family 6 carbohydrate binding module, CBM6 0.0000716
Further Details:      
 
Domain Number 6 Region: 658-719
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000687
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297593|ref|YP_005047784.1|
Sequence length 1085
Comment putative xylanase/chitin deacetylase [Clostridium clariflavum DSM 19732]
Sequence
MTKKLMAFFSTLLCCSFLFTLLPANVQAMTLTNNATGTYQGYDYEYWKDTGNGTMTLTGP
GTFTCSWSNINNILFRTGKRLGSQKTYQEYGNIYIEYDCDYRPNGNSYLSVYGWTQGPLV
EYYIIESYGTWKPPGSNQVKGYVNADGGQYEIYQTTRYNMPSIEGDKTFDQYWSVRTQKR
TSGTISVHEHFKAWESRGMRMGRLYEVSMVVEGYQSSGQANMKKMNLVIGGQAPSTSTPK
PVTEKNAFQKIEAEDYDDLVGSEARSIGTGIGYINNGDYAVYKSVNLGSGAGSFKAYVAN
GNTTSTTIQLRLGGTNGALIGTLTVPSTGGWDTYQEVTTNVTNASGTKDLYLCFSGPVNV
DYFVFDTSSNTGGNNGGGGNTGGGNTGGGNNGGWPGGGWPGGGNTGGNTGGGTKTVTNNE
TGTHGGYNYEYWKDNGNGTMILKDGGSFSCEWSNINNILFRKGIKYDETKTHQQIGTMEL
TYECDYQPNGNSYLAVYGWTSDPLVEYYIIESWGNWRPPGNEPVKGTITVDGGTYDIYET
TRVNQPSIKGTATFQQYWSVRQQKRTSGKISVSEHFKAWESRGMKMGKFYEISLVVEGYQ
SSGKADVKSMSISINGVPHGSTGGNTGGGNTGGGNTGGGNNGGGNTGGGNNGGNTGGLLG
DVNNSGTIDSIDLAIYKQYLLGMISSFPAPQNADIDNDGNYTSIDFAMIKQHLLGMIDLT
TRGNPNNGGNNGNPDNTSPIDAFSKIEAENYSSNSSSTMEKIGTDNGGSGLGYIENGDYI
VFKNVNFGSGANSFTARVAYGGNSSTTIQLRLGSSTGTIIGSLNVTSTGGWDSYRELSTS
VSGASGTKDLYLCFNGPVNIDYFTFSTQSVPTSSPTSQPITGKKLVALTFDDGPSYQTTL
VLDKLKKYNAKATFMVVGQNIASNGSVMQRIVAEGHEIGNHSWSHQDMRYMSASQIQNEI
NQTNAAVRQYTGYDPKFFRAPNLSVGGAMTSTINMPFVQGVIAQDWNGGSATTAQARAQI
VINGVRDGSIVLMHCTQPGNHPTPEALDIIIPTLQNQGYAFVTLSELFSAKGITPRPGVT
YDGAF
Download sequence
Identical sequences G8LXE2
gi|374297593|ref|YP_005047784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]