SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297626|ref|YP_005047817.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297626|ref|YP_005047817.1|
Domain Number 1 Region: 216-344
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.88e-23
Family Cellulose-binding domain family III 0.00069
Further Details:      
 
Domain Number 2 Region: 360-489
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.19e-22
Family Cellulose-binding domain family III 0.001
Further Details:      
 
Domain Number 3 Region: 56-188
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.45e-22
Family Cellulose-binding domain family III 0.00052
Further Details:      
 
Domain Number 4 Region: 496-575
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000000432
Family Pre-dockerin domain 0.001
Further Details:      
 
Domain Number 5 Region: 591-645
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000126
Family Type I dockerin domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297626|ref|YP_005047817.1|
Sequence length 647
Comment Cohesin domain protein [Clostridium clariflavum DSM 19732]
Sequence
MKRVLCMFLTYAMLFGIFLTSLNLEASYAYPIDSESITSSQNTPVISATPIPQKDFTVEI
ASEHKELDGNVIIPITFSNVPEKGILTCDMTIVYDPTKLEYISCDIGDIVINPETNLVVS
KVYDGLIKLLFLDETLGNELITSDGIFISPIFKKLQSYNESTSIKIIRSTFGDFNLNEVK
AKIIQTADNIPIPSSIVLPTSISTPKPTPTPTPIIFQFAIGSANGNTGELVTVPINFLNV
PENGISTVDIEVTYNPTLLEFVSAAPGAVIPSPDQNFNYNTSSESSINIQYSKDSETPAC
ITSNGEFANITFKVLCKYDINTYISVRSYTFKDGDLQDVYATPRSTGTIYISGIELPSFG
IEIGSVNGYANDLVTVPIYFTSIPFNYIVSFDLTLNYDPSQLEYISYEPGEILKESDFCF
GIEKISDGKLNLSYLNYIEGYIYKSGLLANLTFRVLGSAEETTVNITESSVANRTLKRVN
PIITPGKVNLLPSSGYKVSGYVYSELENNNTSNNSFNEGFKVELSGTNLSALTDKSGYFE
IRNIPAGTYSLKITKPNYLAREIKDFIVEKDKELSSPIVMWIGDMEIDGVQDGAINMEDI
MEICKAFNGVSGDAVYKESLDLNKDSAINLEDIMIVVKHFNKTSADY
Download sequence
Identical sequences G8LXH5
WP_014256423.1.34793 gi|374297626|ref|YP_005047817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]