SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297688|ref|YP_005047879.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374297688|ref|YP_005047879.1|
Domain Number - Region: 18-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00392
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297688|ref|YP_005047879.1|
Sequence length 149
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MPFSQSTKELLIKSGWYENRKIDTTELERLIESRGFKVFPKVKEFLQEYGMLEFRIHHPD
IKSEVIVHNTNPIQALGDAGDRRIVAQFEELAKEELVIVGELHNRNLFLMISETGKVFCD
NGKHGNNFEEALESILNYKSCMAWQNIKE
Download sequence
Identical sequences G8LY23
gi|374297688|ref|YP_005047879.1| WP_014256484.1.34793 WP_014256484.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]