SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297860|ref|YP_005048051.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297860|ref|YP_005048051.1|
Domain Number 1 Region: 16-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000146
Family Laminin G-like module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374297860|ref|YP_005048051.1|
Sequence length 396
Comment hypothetical protein, partial [Clostridium clariflavum DSM 19732]
Sequence
MAIKSILTNQEDFTGEFPVTSRTSALWRFNEKTPDENLQLIDSSGHGRHFTISGWSGTSA
NLIAGRFGRYFRQNIVNPTSEKTHLIAENDGSFFSNLGEKIVVGGWINPTTYSVGQTYIP
IFNTRQGPGQPIFYVSLYQGRLRLMLYNSSGTLIYDQSETATITLKNGGWYFIASIIEVS
NKKVQNIICDRSDGATWVSPVRSFSGELNRECIADIIMGMHANTYYYAGGFDDWFLETDS
QLTADDLLLYFKSSLHANGGDAASDVDALAEPGSVTLKATDGEYPASGVLYTRAVPCALS
GSGRVAVTSEYTAGVTSVSLVETSTSDDLEEWSAWQAVGTSGELQSPNRQYIRFRVTLTS
SDPLRTPKLLEIQLHDIPKAPYEKLGFARPVILDKN
Download sequence
Identical sequences G8M020
gi|374297860|ref|YP_005048051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]