SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298090|ref|YP_005048281.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298090|ref|YP_005048281.1|
Domain Number 1 Region: 307-795
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2e-152
Family Cellulases catalytic domain 0.00000000000112
Further Details:      
 
Domain Number 2 Region: 50-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.44e-37
Family CBM4/9 0.002
Further Details:      
 
Domain Number 3 Region: 213-303
Classification Level Classification E-value
Superfamily E set domains 4.48e-25
Family E-set domains of sugar-utilizing enzymes 0.000096
Further Details:      
 
Domain Number 4 Region: 813-875
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000294
Family Type I dockerin domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374298090|ref|YP_005048281.1|
Sequence length 877
Comment putative carbohydrate binding protein,dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MIYNRVKNANKLKSVIAAFAVTTLLTTSIQPAVYAGEDNHPELPPYQKDLLYERTFDEGL
CYPWHTCEDSGGVCDFDIKNGALVLKITNPGQNEWSCQMRHRGITLVQGHTYTVRFKVWS
NKNGAKVYAKIGMQGEPYTDYWNNQWQKIDLTTSPKLVQAEFTMNSATDETVEFTFHAGG
ALNTAGTEIYFDDISLYDPLHDKPVIEVLEMPDVRVNQVGYYPNRAKKATVVTNSTSPVG
WTLYDSSGRAVKTGTTKVKGLDKDSQDYVHIIDFSDFTTPGKGYYFKVDTNSSKNYSHKF
DISEDILSDMKMDAIKYFYHNRSGIAIEMPYAGRQDLTRPAGHIGVYPNLGDTNVPTWPN
TGQKNYSLDVSGGWYDAGDHGKYVVNGGISLWTMLNQYERAKKDNVLHLAPYKDGSMNIP
ESGNGLYDILDEAKWEMDFILKMQVPSSKDPDLAGMVHHKVHDESWTALGLLPHEDPKQR
YLRPVSTAATLNLAATAAQAARIWKDIDPSYSNKCLQAAEAAWEAAKKHPKIYAPNEQPG
GGPYNDEYVEDEFYWAACELFITTGKSEYKDYIKSSRHYLEMPSILSSGEDDGLYGCFTW
GSTQGLGTVSLALIPNDLGESEIQKARQNIAKAADVWLANIEEQGYGLPIKADRNGNYPW
GSNSFILNTMIVFAYAYEYTGDTKYLDGMTSSMDYILGRNALDQCYVTGYGERPLQNPHH
RFWAYQLSKKFPKPPAGCVSGGPNSNFQDPTINAAMKKDTPPQKCFMDHIDSWSTNEITI
NWNAPFAWATAYLDEKGNTPSNGGGTNPGGEDIVLGDINFDGDINSIDYALLKAHLLGIN
KLSGDALKAADVDKNGDVNSIDYAKMKQYLLGISKEF
Download sequence
Identical sequences G8M2I7
WP_014256858.1.34793 gi|374298090|ref|YP_005048281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]