SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298093|ref|YP_005048284.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298093|ref|YP_005048284.1|
Domain Number 1 Region: 658-921
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 4.32e-21
Family YVTN repeat 0.019
Further Details:      
 
Domain Number 2 Region: 251-507
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.61e-16
Family Quinohemoprotein amine dehydrogenase B chain 0.072
Further Details:      
 
Domain Number 3 Region: 36-106
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.32e-16
Family Type I dockerin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 536-626
Classification Level Classification E-value
Superfamily PKD domain 0.0000116
Family PKD domain 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|374298093|ref|YP_005048284.1|
Domain Number - Region: 148-209
Classification Level Classification E-value
Superfamily PKD domain 0.017
Family PKD domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374298093|ref|YP_005048284.1|
Sequence length 939
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MFNFKKLSLFLLAALIAVQFIPGSRANVFADTGSNFVYGDVNGDGSVDSLDLIILQKYVL
GNIDKFPSENGVKAADLDVNGVVDSIDYELFKQYLTGKIKDFPVNNSPATSLIAQSTPIP
LELKDNNIVSYKSFNVSLGNSIGSVPREESLSYNWRVISQPSESNALIDNPSIKNPNFTA
DTAGDYVLGVTVSNRRVTSDEKTLNVKIKEFGATTDDIDENAFTKNYLTGYDFSDYIPLS
DGWIIVKSKASNKVIFLNVFTGTHGKEFVVDGTPDRMEFDFEREILLVSLKDNNSIAKIN
MKTEKITYIDIGNNIVDITLGEKGIVFVLGVNGTGRVIYVVDIIKGKIKNSISVKEKYGI
MVYDKEENNLIAGELGYSPSTLGRYSFDENTFSLETQQISNDVGSNGQDLAISVDGKHVA
FSCGGGNGKGYTIFDIDSSDINKKFGEWDIGAYPRSADFSLDSKYLVASNGFEVKIFNVE
NHKAIGVVSKASGSKCNVSFSRGGKIVYDAGTDILYINQSGIIQAEVEPPQVLQSPTART
TGDRIALKGIEVNLDGSASDKGSGTYIEYEWAIVSKPGNSQVVIENENMVKANFAPDMAG
QYCISLTVSNEAGESEPAFVNITVQNISDTVDIIESIEEGYLEGYLPIKPIALPSGWIIA
ADTRNVVKIINVMTKEVIAQYQVSAIPNKLSYDFENDRIVVSLKSDKRIAVIDINEDSVY
YIDTPYSYNGIVYGEENIAFAISDDWPKGYISIIDIQEKKVLNSIEVSVYKSGLIEYDPI
YNNLFFADSGTSPSSLYRYSFNEVTKELKIEQKINNAGGNARDMNISNDGKHLVLCCGSG
NGDGYTIFDFDATNLERKFDEFDTGAYPNSGAFSNDGNYFIASNGSKLLLFDANNHSLIN
TIKSGSYAAAYDKVLFSRGDNIIYNIVESRIYYYKNPIY
Download sequence
Identical sequences G8M2J0
gi|374298093|ref|YP_005048284.1| WP_014256861.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]