SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298126|ref|YP_005048317.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298126|ref|YP_005048317.1|
Domain Number 1 Region: 181-333
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.71e-43
Family Cellulose-binding domain family III 0.00000833
Further Details:      
 
Domain Number 2 Region: 1226-1445
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.95e-25
Family NodB-like polysaccharide deacetylase 0.0046
Further Details:      
 
Domain Number 3 Region: 808-1025
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.73e-16
Family NodB-like polysaccharide deacetylase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374298126|ref|YP_005048317.1|
Sequence length 1451
Comment putative xylanase/chitin deacetylase [Clostridium clariflavum DSM 19732]
Sequence
MRLRKTVISLSMVFCMLFTQISANAANSNGIATENGRVRITKEVKERFKASAKKLKEVEK
AAIKGMELEREKEKKVKEEANKSIASIIAGKTVDQDNLSITENFPEIKELMPSNTLLESK
KSEKALTKGKETEKTEKKSEKQAKRSNFNLNSNESALFATDTELIFSNLFMPLVSQLAVA
PELKIETYSGNPTNSINSIMPRFKITNTSKVPIELKYVKLRYYYTNEEEKEQNFWCDYAA
ILNPKHSPLTGVTGKFYKLSPATQDANYYLEISFSGGVLEANCSAEVHTRFAKKDWSNYI
QTNDYSFNSSSSYINFDKVTAYINGNLIYGTEPEIKPTLTPTVTPTPTKTATPIITDKPS
KTPKPEKTPKPEKTPKPEKTPTEVPTPTEKPKDTPAPTPTKVPIETPTPTPTVVPTERPT
PTPTAEPTEAPTPTPTEKPKETPTPTPTEEPIETPTPTPTAEPTEAPTPTPTEKPKETPT
PTPTEEPIETPTPTPTAEPTEAPTPTPTEKPKETPTPTPTEEPIETPTPTPTAEPTEAPT
PTPTEKPKETPTPTPTEEPIETPTPTPTAESTEAPTPTPTEKPKETPTPTPTEEPIETPT
PTPTAEPTEAPTPTPTEKPVETPTVVPTETPTPTVTPKPSGSNLLLSDGITLSEGDSIAE
WDLTYNADIIVDTTNYISGKESLKVSSQGMSGVDYFVIEQHSFNRDLSDFENLEINIFVP
DVAKISTVSIAFFCDEINYSSYFTTFIGNYQLRNGWNKIRVARNDFIAFGSNANWNDIRS
MRITVSTRASDIYVNIDRIAYNVKGLPKLIFTFEDGYYSVKSNAFPILNEKGFKANVMPV
KSITEVGSVAFLDKYDLHELYAAGWDIGNHTESHPLSIEGYTTEAKESEFLNAQNWLIDN
GWTRGAYNVYYPSGFYDSEIKGIVKAIGAKTAMYTDYGIQAVPVEDIYNLRSISIGEEVS
IEWVKSEIDRAIATGSTIILNAFKVEDNPVLGFEMSTQYFRELVEYVYSKSSQNLIEVVT
FSEWYNDYMGLDDEPVVPPTPIPTIEPTPEPTFIESYIPVNGTSLQTSEGIIIEEFDVID
YTYNFRRAKAEISTHNVSGSGSLKLTSQVPDGGFNFTLEKRYTYGLDLSSMKNIEFNLYV
PNASEITAISVGMYTDNIYFGSYFVNYIGAYELYSGWNKIVRRSSDFISVGSSDWSNIKS
IIITVYAKEGFRPSIYLDKIAYNIEGKSKLLFTFDDAWHDVLTEAKPIMDAKGFKGTLWV
TYELATGGEPEYLNPDELDYMYKEGWDIGNHTKGHFDDITVLSAEEKREEYLFCQNWILE
NGWTRAAHHVCYPQGSFDEELIKILQEIGVKTARTTLTGIQPVPVENIYKLKCIPVGKDL
SVDWIKNEIDRAVETGSSIMFMLHQVEKVPVEVYSISTESFAEIVDYVDNYVKQGKLEVQ
TISEWYESYIN
Download sequence
Identical sequences G8M373
WP_014256893.1.34793 gi|374298126|ref|YP_005048317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]