SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298127|ref|YP_005048318.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298127|ref|YP_005048318.1|
Domain Number 1 Region: 25-242,287-501
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.76e-57
Family Pectate transeliminase 0.018
Further Details:      
 
Domain Number 2 Region: 526-589
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000114
Family Pre-dockerin domain 0.00096
Further Details:      
 
Domain Number 3 Region: 595-661
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000912
Family Type I dockerin domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374298127|ref|YP_005048318.1|
Sequence length 665
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MLKNLFPIALFSFIYIFTPCFNVNITSAQVINYYVSPNGNDNNPGTFEKPFKSIKKACEM
VMPGGTVYLRGGIYNENITIKSSGSEQKGYITITNYPGENPILDGSGLTVPNEYTGMIFI
ENKSFIRISGLEIRNYKTSAVDPVPVGIHIRGSANNIEIKNNKIHNIETAAKDNRVGNAH
CIAVYGTASIPAKKITIEGNEIYNCKLGSSEALAVNGNVEDFQIINNYIHDNDNIGIAVI
GWENTSYTDDQARNGIIAGNTVSFISSYGNPAYGKEYCAGGIYSDGARDVIIERNRVYNC
DIGIEVASEHKGKSTSNISVLNNILYNNNLTGIAFGGYDKNRGSTINCKFINNTLYNNDT
KRTGCGEVLMQFSTNGNIFCNNILYSGNQNLFISNVYKENNGNIFDYNIYYSVGGAASSE
WIWKNEYIQSFDKYRSITGNDKHSKFVDPQFIDLSSDLPDFHIKEGSSAINAGDPANCAE
YDFDGNKRNSYQGVDCGAYEFSPVPVKNKTYTLAGYIKCNVETKYPEINKGIKVEIVQTG
DYTYTDSNGYFQLPNVPYNDKGYSIKISKQTYLTRYINDMIVDKDVVIGSKAAPVILLPG
DINMDGALTIDDIGLISQKLNAVSSDLSYSQVMDLNFDSVINLEDIMIIARNYGKKISDY
PKILD
Download sequence
Identical sequences G8M374
gi|374298127|ref|YP_005048318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]