SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298176|ref|YP_005048367.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298176|ref|YP_005048367.1|
Domain Number 1 Region: 27-648
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.87e-263
Family Cellulases catalytic domain 0.000000000000571
Further Details:      
 
Domain Number 2 Region: 664-726
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000128
Family Type I dockerin domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374298176|ref|YP_005048367.1|
Sequence length 728
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MKKTAMFLLAFALLASSIQPAAKVKADSDTFKDRFNYMYNKIHDPANGYFDSEGIPYHSV
ETLCVEAPDYGHESTSEAASYYAWLEAVNGKLNGKWSGLTEAWNVVEKYFIPSESIQKGM
NRYNPSSPAGYADEFPLPDDYPAQIQSNVTVGQDPIHQELVSAYNTYAMYGMHWLVDVDN
WYGYGTGTNCTFINTYQRGEQESVFETVPHPSIEEFKYGGRQGFSDLFTAGETQPKWAFT
IASDADGRLIQVQYWANKWAKEQGQNLSTLNAKAAKLGDYLRYSMFDKYFMKIGAQGKTP
ASGYDSCHYLLAWYYAWGGAIAGDWSWKIGCSHVHWGYQAPLAAYALANDPDLKPKSANG
AKDWNSSFKRQVELYAWLQSAEGAIAGGVTNSVGGQYKSYNGASTFYDMAYTYAPVYADP
PSNNWFGMQAWSMQRMCEVYYETGDSLAKEICDKWVAWAESVCEADIEAGTWKIPATLEW
SGQPDTWRGTKPSNNNLHCKVVNYGNDIGITGSLANAFLFYDQATQRWNGNTTLGKKAAD
KALAMLQVVWDTCRDQYGVGVKETNESLNRIFTQEVFIPAGWTGKMPNGDVIQQGVKFID
IRSKYKDDPWYEGLKKQAEQGIPFEYTLHRFWHQVDYAVALGIAEIFGYKPPKGGSGGGE
TGDIKLGDINFDGDINSIDYALLKAHLLGINKLSGDALKAADVDQNGDVNSIDYAKMKSY
LLGISKDF
Download sequence
Identical sequences G8M3C3
gi|374298176|ref|YP_005048367.1| WP_014256942.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]