SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298322|ref|YP_005048513.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298322|ref|YP_005048513.1|
Domain Number 1 Region: 37-166
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.19e-32
Family Cellulose-binding domain family III 0.0002
Further Details:      
 
Domain Number 2 Region: 208-337
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-32
Family Cellulose-binding domain family III 0.00023
Further Details:      
 
Domain Number 3 Region: 379-508
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.93e-31
Family Cellulose-binding domain family III 0.00019
Further Details:      
 
Domain Number 4 Region: 649-748
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-31
Family Cellulose-binding domain family II 0.00021
Further Details:      
 
Domain Number 5 Region: 530-632
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.35e-30
Family Cellulose-binding domain family II 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374298322|ref|YP_005048513.1|
Sequence length 748
Comment cellobiohydrolase A (1,4-beta-cellobiosidase A) [Clostridium clariflavum DSM 19732]
Sequence
MYLSKFTKCISIVLCALILCTLMPLQKTEAASAEFTAYVESVTANVGQQVVVPIKLANVP
SNGITTADMTITYDPSKLEYVNGSAGSIVMNPSVNFAINKENNGTIKILFLDETLLNEYI
REDGIFANITFKVLGTSTVTISKATFGDRTLKPMTAKLNAGTITINGGATTQPTTPPTPT
PTVRPTTPPTVPPTVPPTTPPVITGFTAYVESVTANAGQQVVVPIKLANVPSNGITTADM
TIIYDPSKLEYVNGSAGSIVMNPSVNFAINKEDNGIIKILFLDETLLNEYIREDGIFANI
TFKALGTSTVTISKATFGDRTLKPMTAKLNAGTVTVNGGATTQPTTPPTPTPTVRPTTPP
TVPPTVPPTIPPVITGFTAYVESVTANAGQQVVVPIKLANVPSNGITTADMTIIYDPSKL
EYVNGSAGSIIMNPSVNFAIHKENNGTIKILFLDETLLNEYIREDGIFANITFKALGTST
VTISKATFGDRTLKPMTVKLNAGTVTVNGGATTQPTTSPTPTPTPTLTPPPQSGNFSVNY
TQSDWGTGATVSMTITNNGSTAVNGWTVRFNFDGNQKITNAWNCSFTQNGNSIVLTNVDY
NATIPAGGSVTIGFNISYTGTNKAPTNFIVNATSSGGTDNPVPTPPPSQNNNCSVTYTHN
DWGSGATVSITIKNNGSTAVNGWTVNFTYAGNQKITNAWNCSYTQNGNSVTLKNVDYNST
IPAGGTITIGFNITYSGTNSIPTNITVN
Download sequence
Identical sequences G8LUE1
gi|374298322|ref|YP_005048513.1| WP_014257085.1.34793 WP_014257085.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]