SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374298371|ref|YP_005048562.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374298371|ref|YP_005048562.1|
Domain Number 1 Region: 33-167
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.01e-32
Family Cellulose-binding domain family III 0.00025
Further Details:      
 
Domain Number 2 Region: 328-456
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.57e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 3 Region: 481-609
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.57e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 4 Region: 635-763
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.57e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 5 Region: 788-916
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.66e-31
Family Cellulose-binding domain family III 0.00017
Further Details:      
 
Domain Number 6 Region: 194-295
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.07e-30
Family Cellulose-binding domain family II 0.00014
Further Details:      
 
Domain Number 7 Region: 942-998
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000000000994
Family Cellulose-binding domain family III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374298371|ref|YP_005048562.1|
Sequence length 1001
Comment cellobiohydrolase A (1,4-beta-cellobiosidase A) [Clostridium clariflavum DSM 19732]
Sequence
MYMSKFKRFISVVLCAFLLCTLLPIEKAEAAGFTVSVESVSGSFGQQIVVPVKFSNVPSN
GIITADMTITYDSSKLEYVSGEAGSIVTNPSINYAINKDKDGSIKVLFLDDTLTSGYISR
DGVFTNLTFKVISSASTTATVTVNKANFGDRNLSPITAQFSAGTITLNSGNSTIPTTQPT
TPPWTQPTTPPQNSSGNFSVNYSQNSWGTGATVSMTITNNGSSAVNGWTVNFTFPGNQKI
TNAWNCTYTQSGSSVTINNVDYNAVIPAGGSVTIGFNISYSGTNEAPTNFIVNSSSVNPG
NPTQPPFQPTLPPTSQPSTGPIVTGFTAYVESVTASAGEQVVVPIKLANVPSNGITTADM
TITYDASKLEYVKGEAGSIVINPSINFAINKEKDGIIRILFLDDTLLNEYISKDGVFANI
TFKVSGTSTVTISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTPTPTQPTTGPIVTGFT
AYVESVTASAGEQVVVPIKLANVPSNGITTADMTITYDASKLEYVKGEAGSIVINPSINF
AINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFGDRSLKPVSA
TLTAGTVTVGGGTTQPTVPPTSQPTTGPIVTGFTAYVESVTASAGEQVVVPIKLANVPSN
GITTADMTITYDASKLEYVKGEAGSIVINPSINFAINKEKDGIIRILFLDDTLLNEYISK
DGVFANITFKVSGTSTVTISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTPTPTQPTTG
PIVTGFTAYVESVTASAGGQVVVPIKLANVPSNGITTADMTITYDASKLEYVKGEAGSIV
INPSINFAINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFGDR
SLKPVSATLTAGTVTVGGGTTQPTVPPTSQPTTGPIVTGFTAYVESVTASAGEQVVVPIK
LANVPSNGITTADMTITYDASKLEYVKGEAGSIVINPYNKL
Download sequence
Identical sequences G8LUJ0
WP_014257133.1.34793 gi|374298371|ref|YP_005048562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]