SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294921|ref|YP_005045112.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294921|ref|YP_005045112.1|
Domain Number 1 Region: 284-811
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.43e-116
Family Glycosyltransferase family 36 C-terminal domain 0.00000003
Further Details:      
 
Domain Number 2 Region: 1-265
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-86
Family Glycosyltransferase family 36 N-terminal domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374294921|ref|YP_005045112.1|
Sequence length 811
Comment cellobiose phosphorylase [Clostridium clariflavum DSM 19732]
Sequence
MKFGYFDDLNKEYVITTPTTPYPWINYLGTQEFFSIISNTAGGYAFYRDARLRRITRYRY
NNVPIDMGGRYFYIYDNGDYWSPGWSPVKKELDSYECRHGLGYTKITGKRNGIKAEVTFF
VPLNYNGEVQKVIITNEGNDTKKITLFSFIEWCLWNAQDDMTNFQRNFSTGEVEVEGSVI
YHKTEYRERRNHYAFYSVNVPITGFDSDRDSFIGLYNGFDAPKAVVAGKSNNSVADGWAP
VASHSIDIELKAGEKKELVFILGYVENNPDDKWEAKNVINKKKAKEMIDKFKTVADVDKA
FSEFKEYWNSLLSQYTIKSHDEKLDRMVNIWNQYQCMVTFNMSRSASYFESGIGRGMGFR
DSNQDLLGFVHQIPERARERLLDLAATQLEDGGAYHQYQPLTKRGNNEIGGNFNDDPLWL
IIAAAAYIKETGDYSILNEMVPYDNDMSKADTFFDHLKRSFNHVTNNLGPHGLPLIGRAD
WNDCLNLNCFSSTPDESFQTTTSKDGKVAESVMIAGMFVYTGPDYVKLCRYMGEEEEAKK
AEKAIEDMKEAIIKHGYDGEWFLRAYDDFGRKVGSNENEEGKIFIESQGFCVMAGIGLDD
GKAVKALDSVKKYLDTPYGIVLNNPAFTKYYIEYGEISTYPPGYKENAGIFCHNNAWIIC
AETVVGRGDMAFEYYKKIAPAYVEEISDIHKTEPYVYAQMIGGKDARRMGEAKNSWLTGT
AAWNFVAISQWILGVKPDYDGLKIDPCIPKDWDGYTVSRLFRGATYVIEVKNPDHVSKGV
KKVTVDGKEIEGNIIPVFGDGKEHKVEVIMG
Download sequence
Identical sequences G8LSC7
WP_014253820.1.34793 gi|374294921|ref|YP_005045112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]