SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296141|ref|YP_005046332.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296141|ref|YP_005046332.1|
Domain Number 1 Region: 32-191
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.24e-53
Family Cellulose-binding domain family III 0.00000229
Further Details:      
 
Domain Number 2 Region: 919-1078
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-52
Family Cellulose-binding domain family III 0.00000353
Further Details:      
 
Domain Number 3 Region: 1155-1313
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.97e-51
Family Cellulose-binding domain family III 0.00000397
Further Details:      
 
Domain Number 4 Region: 375-542
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.23e-49
Family Cellulose-binding domain family III 0.0000203
Further Details:      
 
Domain Number 5 Region: 546-706
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.56e-48
Family Cellulose-binding domain family III 0.0000105
Further Details:      
 
Domain Number 6 Region: 717-872
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.49e-46
Family Cellulose-binding domain family III 0.00000315
Further Details:      
 
Domain Number 7 Region: 204-362
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.97e-46
Family Cellulose-binding domain family III 0.00000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296141|ref|YP_005046332.1|
Sequence length 1317
Comment Cohesin domain protein [Clostridium clariflavum DSM 19732]
Sequence
MRIRKFLSVFFVIALLISSTLFPSIVFADTQNSSIELRLDKTNAEIGDIITATVYINNIR
NFAGYQVNLKYDPEVLQPVTKAGKPYTNSTNPESGTLLNNSEFGAFAQALNNIEEGILNF
GKVYTRLEDYRSSAEAESSGSVAVINFKVISDKPTSIVFEDTYRMPGAVTGTMIFDWNGN
RISSGYSVVQAGLINSDNQNPVTESNISLTYDKTTAKVGETVKVYLSVNNIFGLSGYQVN
LKYDPDVLQPVTSSGKPYSSSTNLSGGDLIKNSDYSPFYQASHNLEEGILNFAASYLNLP
EYRASNNAETTGTLGVIEFRVLDAKATAVSFEDSKYMPNSYSGTLLFDWNAEKISGYKIN
QAGILNSEEQPILNGNVYMELDNTEVEVGDIINASIKVDNIADLAGYQINLSYDPTVLKP
VTIDGKDYKNTTLPLKGDIIVNNDYSPYFIASHNLSAGTLNFTGSYLDLEAYRNSGNAET
KGTLATISFKVLKAQSTSILFENSSSMPNGISGTMLFDWYGNRILSGYNVNQAPVINVAD
PTGSQKGKILLELDKTEASFGDIITATLRADGIDNLAGFQVNIKYDPKVLQPVNPATREP
YNSNTNPEEGDIIVNSEFEPVSFALHDLKSGILNFSRSYTNLEAYRASESEKSGILAKIS
FKVTLSETLTYIRLENTGTMPNAIDGTMLFDWYGNRINSGYEVIQPEAINKDNSYKAISI
SIDKNNPSVGDIINASILILNIDKLAGYQFNIKYDPEVLQPVDSNGVPYTNETIPAAGGL
INNEDFGIFAVASHNLEKGILNFSKLYTDLEGYKKSGKPETLGIVATISFKVLSKKITSI
MFENTNTMPNAIDGTILFDWNGERIKSGYQVIGSPYINAGSTSDCVKTFSPSPTYTSTPK
PENTPIITPVPTDGQVIEDSFITIDFDKTCAKVNDTITATIMVENIDNLAGYQVNLKYDP
NMLQPVTSSNTPYTNSSIPSKGTLISNANFGPISAASHKLSEGILNFGRLYTNLADYRAS
QAPEKTGSLAVVTFKVLKAGDTSIAFENTASMPNAIDGTILFDWYGNKIKSGYKVLQPAE
ICIESIDPVASPTIICTSPTPTPVVTSTTQPTATPTNVCTSPTPTPVVTSTTQPTATPTP
VVTPTATSTNPALSRYITIEFDKTSAKVGEIIKAIIKVNEIKNLSGYQINLKYDPDVLQP
VKPSGASYTNGTIPSSGTLISNEEFYPLNAVSHDLSKGILNFGKFYILLDDYKNSGTIED
TGTIAVIEFKVLKEIETYVKFENSSSMPNGINGTMLFDTDGNRITSGYTVIQPEKIN
Download sequence
Identical sequences G8LU20
gi|374296141|ref|YP_005046332.1| WP_014254994.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]