SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296316|ref|YP_005046507.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296316|ref|YP_005046507.1|
Domain Number 1 Region: 36-422
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.95e-67
Family beta-glycanases 0.00000687
Further Details:      
 
Domain Number 2 Region: 493-560
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.79e-16
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296316|ref|YP_005046507.1|
Sequence length 561
Comment endoglucanase [Clostridium clariflavum DSM 19732]
Sequence
MKKLIIFSVLLVLLVALLPTPGLQISAETTNVGAPDDDWLHVENGYIVDKYGNKVWLTGA
NWFGFNCREMMLLDSYHSDIIADIQIVADKGINVVRLPIATDLLYSWSKGIYPMSTDTSY
NNPILAGLNSFELFNLMLENFKKVGIKVILDVHSPETDNMGHNHPLWYKGEITEEIFKAA
WVWVANYYKNDDTIIGFDLKNEPHTNTGTLKFKSQSAIWDDSDHKNNWKRVAQETALEIL
KVHPNVLIFVEGVEMYPKDGKWDDESFDTSPWTGTNDYYGNWWGGNLRGVRDYPIDLGKY
QSQLVYSPHDYGPIVYEQSWFAGDFVTASDEEAKKILYEQCWRDNWAYIMEEGISPLLLG
EWGGITEGNHKLLDLNLKYLRCIRDFILENKYKLHHTFWCINIDSADTGGLFTRDEGTPF
PGGRDLKWNDNKYDNYLLPVLWKNEEGKFQGLDHEIPLGKNGVPLPKGTSPVTPTKTPVT
PTPTSTPTPTPSNVIKGDINGDGEINSIDYAILKSYLLGLTKNLPAEDELAVADLNGDKE
INSIDYALLKMYLLGMIKDFS
Download sequence
Identical sequences G8LVJ4
gi|374296316|ref|YP_005046507.1| WP_014255163.1.34793 WP_014255163.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]