SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374297242|ref|YP_005047433.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297242|ref|YP_005047433.1|
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-19
Family Thioltransferase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374297242|ref|YP_005047433.1|
Sequence length 75
Comment small redox-active disulfide protein 2 [Clostridium clariflavum DSM 19732]
Sequence
MVIKVLGSGCCNCKKLEANVREAVKELGLEATIEKVEDFKDIMAYGVMRTPALVVDEQVK
IMGRVPSVEDIKRYL
Download sequence
Identical sequences A0A1M6J500 A0A2K2F7R3 G8LU77
gi|374297242|ref|YP_005047433.1| WP_014256055.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]