SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE02606 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE02606
Domain Number 1 Region: 73-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000243
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE02606   Protein: RP43050   Gene: WBGene00070855
Sequence length 375
Comment RP43050 WBGene00070855 status:Predicted
Sequence
MVYYVYLYPTMANVRFDTKQEEEIEYHTDRRFHKEDVRCAGRQGKEGTKKQTPPHAQAQN
SNKDPANKNATKGDGEILAIKVLIPSSAVAAIIGECGVVMNTLRKDHKCQIQISKNETYP
GTLEQICIMKGSLRNILAVIESIQEKIRMKCADQNLFQKFLNNGNVSLCGAQVLIAVKRY
PDESDVSDIISQLRDNHVMVRIAVDSIPSGGSNSASLYEMAYQTNGYCAFATGSDLSITF
DWMTSMLQNPYQFVAQNFLVSGTGRIELAVFKTPKPPGSTDWCLFAVTVQNHTLDNSFIS
MNYTIESTDRSSVFKFPSDNSAPLYGTEQTDDFIFYSSLSYKWTIDYQYNNDEPQIIECR
MYSESYHDFVPLPDF
Download sequence
Identical sequences E3N9U0
31234.CRE02606 CRE02606 XP_003094823.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]