SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE02717 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE02717
Domain Number 1 Region: 144-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 
Domain Number 2 Region: 50-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.01e-21
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 1-52
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000157
Family ECR1 N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE02717   Protein: RP50420   Gene: WBGene00086257
Sequence length 273
Comment RP50420 WBGene00086257 status:Predicted
Sequence
IVIPGQAVCDAPQQFMRGHGTYIRDGEIVSSLSGVVQQLNRLLMVKTIKQRYAGEVGDVV
VARVVEVQAKRWKCDVSSRLHANLPLGSVLLPGGDFRRKDVEDEEKMSEFLKNGELICAE
VQQVQHDGTLMLHTRNNKYGKLQQGILIKVPPHLIKKSKKHFHTLPYGMAVIIGCNGNVW
VTPALPETTVEEDGSHVHEFQIVPQDIRLVMIRVAACVRLLRDYSISIFLNSLTTCYEMS
QPYDIKELSEQETSSRLAYLIAARLLQELQQQK
Download sequence
Identical sequences E3NP86
CRE02717 XP_003089783.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]