SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE02951 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE02951
Domain Number 1 Region: 319-409
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000188
Family Tudor domain 0.0021
Further Details:      
 
Domain Number 2 Region: 181-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE02951   Protein: RP47917   Gene: WBGene00055455
Sequence length 519
Comment RP47917 WBGene00055455 status:Partially_confirmed
Sequence
MLTSAPVFVHPTQLPTHIPPPPVFITSSGTLLFPPGFLPPPFPAVADEEELHEFIGAAES
CSSPEPSESFIFSSSSSDVSVAPPLETISFSNVTLNLFSLTGEEEEELKMYARIQEEVKV
KRHRRNSTTSSGYGYSLPRTPTTEILFDTASSQDSGRATGPLASPHDEGLTGTEEDFLPM
YEFEIPNSLVGLIIGVKGKTIKELSQRTNVRMLIRQHHAPDKSKSHQICQVRGKRDEINH
CLQMLRRRFPPARFPELNLQPVVPPVLPNSNFDMLSTQPTWLTLPEEIKCEIAVSSIINP
SHFFVQQPTHATFPSLRHLDMYMGSLYGEQSNLPELPIPCQNGLLCAAPVGNSWFRAVTV
QYYDETDEVFVKFVDYGGYTRIARQELRQIRTDLMSLPFQSSEVMLAHVRPVDGTNNWSD
AAMLKFRELCTGRVIECKMVGYSAETRIPMIELYVTVKEGNETREVRFDQILMGMGLART
ADPSKMSRISYPTTIKDAGDVHMKRPSFSSQTSQTAVVC
Download sequence
Identical sequences E3LWV7
XP_003111597.1.11157 CRE02951 31234.CRE02951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]