SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE03683 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE03683
Domain Number 1 Region: 8-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.36e-26
Family La domain 0.0002
Further Details:      
 
Domain Number 2 Region: 102-170
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000176
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 3 Region: 222-335
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000952
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE03683   Protein: RP00630   Gene: WBGene00060453
Sequence length 401
Comment RP00630 WBGene00060453 status:Confirmed
Sequence
MGETAAVVQDDADAKIIKQLEYYFGNINLPRDKFLQEKIKEDDGWVPITTMLNFNRLAAI
SKDTDKIANAIKSSGSEIVTVSEDNQKIRRNAENPVPENSLEYWQKIKHRTVYMKGFNTD
TQLDDIIQWANQFGETENVLMRRLKPGDRTFKGSVFITYKTREEAEAAQKADAKFGETEL
TKMMQDEYWTLKNKETKEARAANKAAKSAKNTAEAVESEKAQNAVHFEKGLILAVDGLSG
DSSVDSIKTFFKQFGSVGYVAHENGSKTAEIRFNNDSEGGAQKAWDKAAEAGTDGKVILQ
EAEIVGRVLEGEEEEKYWTEFNNRKNQKQGGFHGGRGGRNNRGGRGGRGGRGRGGRGGRG
GRDDRRAEKRGADGDDNGSDGPKAKRTVFNDDGAPAEAAAE
Download sequence
Identical sequences E3LXN5
XP_003111340.1.11157 CRE03683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]