SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE03823 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE03823
Domain Number 1 Region: 165-241
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 2 Region: 76-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Weak hits

Sequence:  CRE03823
Domain Number - Region: 247-302,405-422
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0139
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE03823   Protein: RP27941   Gene: WBGene00070509
Sequence length 453
Comment RP27941 WBGene00070509 locus:Cre-mex-3 status:Partially_confirmed
Sequence
MPVMSPPYSMRNEGYSNNSYGYNRWEPEFWNQMIEETAQKLPGAWYYEEDNASCSPVSDP
DDIAQFLNYRTSIGVQNVTESVEVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPIRGED
PIFVVTGRLEDVREAKREIECAADHFTQIRASRRHSQVVPGAHAPGQVTIYVRVPLRVVG
LVVGPKGATIKRIQQDTHTYIITPSREKEPVFEVTGLPHNVEAARKEIETHIFQRTGNLP
ETEQELMSSGQRGGISLMMQKQLQAQQLQAQQQQHSQQMMYRKFTNGSNLFNQMSNDLPF
SMESSLGLDALLRSFPSMRNSLTPDSLQAFGRNGAPVAQKMQRPSLGAQKQDVGTYDYWN
NNSINDIMENEILSRKYDVLSSWSNIGLEKEKREESPTNGLMSLKGSSTSSGFGFLNTIW
SDNMNLSPGSLPSASPSSSTCDHNDHTLVPISG
Download sequence
Identical sequences E3LXB0
CRE03823 XP_003111171.1.11157 31234.CRE03823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]