SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE06433 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE06433
Domain Number 1 Region: 327-409
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0005
Further Details:      
 
Domain Number 2 Region: 248-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000217
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 4 Region: 73-132
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE06433   Protein: RP31263   Gene: WBGene00054569
Sequence length 476
Comment RP31263 WBGene00054569 status:Predicted
Sequence
MSNFEQRSSAKRTHDDSPDESDESPKRWKQYSYPQEIEKQNAVIRIEHPIPENCAGLGKN
RCIQRKYFFLIPVIGRNGTEIMSISQISQCQLQVIVDLPINGYRMVEIVGTPENVECAKK
CIDETISRAAVNRYSTDSSHSNISNYKITIPIPANKCGLVIGKGGETMRNLRVSLSKKQN
FEINYSLQALSNCFMLLSQDHNLANNTKSLMITGDQKAVEYAKKLVADVIANEYDSPATM
IGNGSLATMSLLVKVPRSSVGKIIGVKGQSIKKIMDETKTKIQFMPDDDPSLMERSLMLM
GKTSSVTVAAHLLKQIVDSTNPQANTSVSVFYMSIPTSKVGLVIGRGGEIIKQINAESGA
HCELSRETGKDPHEKTFVIRGSDVQVEHAKHLICIKVGDIPPNTPFVPRTAQQPQVQMQQ
PYPLQHQYQYPMQYQQPMSIRPDQPQYLQPHFPPVCTQQNYSTLYNQPSALWHSQM
Download sequence
Identical sequences E3M0W4
31234.CRE06433 CRE06433 XP_003109997.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]