SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE08513 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE08513
Domain Number 1 Region: 234-318
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  CRE08513
Domain Number - Region: 107-153
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE08513   Protein: RP41024   Gene: WBGene00079167
Sequence length 364
Comment RP41024 WBGene00079167 status:Predicted
Sequence
MASSTRLSQTYTSPPAVKQQILKPKDQTTTKFPLTEEQRELLITSGCIPNLREIEAGKAA
YIMSDMCSVPPKQQEEMKKVIEEKAYRDARKGKHPIPSRCSNYVYHNKNKILEISGCDDI
SIGSQVYANKYRYVKIKGSPESIIKARQTLDDCCFCHFEEEYDYNVNHRRTNDKVDFFLY
VPKECLRKFNSNEGIRAAQSNALFYSTRVQHQMISVHEDCNPPIIMIGPGDKMREAKASV
VELFAEFSEEKASISIPKNNGFYGHIIGTKGSTIRELSRTTGADIWIDKDEGVAMIEGTK
KSTAAAQVKIQQMVKDYQDQSNRYDAGPSSNKRSTRMSSSLTSRKRRRRDSDCDDVRDYR
QSGF
Download sequence
Identical sequences E3N6W0
XP_003095847.1.11157 CRE08513 31234.CRE08513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]