SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE08549 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE08549
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE08549   Protein: RP15155   Gene: WBGene00072137
Sequence length 369
Comment RP15155 WBGene00072137 status:Predicted
Sequence
MSIPLSTGTYSINGRKYRKTAYQLKVGGASATEITVDQFEDTPDVYEDEPSIGCIAPPPG
LPALKQKIAKAAKKSETTVSMDPQPTEDERITVVGGKKWMATIQVPACFIGKLIGMNRRA
LNSLENDTQCRVKTPRREQKDKPCEITSIISLECVQRCLDRIEIFVDDARKSSRPTHFVA
FSCDHSEIQQNFEVFKKLVMDSDEFHESTRNPQLFTKTSRLHLTISVVRLFDELDMKKME
EAFRVIHDEIKPLLDSAPLIADIQGIDMMNDDPSQVSVIYAKIKGEKVQKIANLVSRRLM
ELLGGNSGNSEDVVADSEDVKLHMTLMNSRYVTQQSDKKNSKNSFNAKKMLEELKELHFG
TIQINEVIN
Download sequence
Identical sequences E3NBA4
CRE08549 31234.CRE08549 XP_003094328.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]