SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE09257 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE09257
Domain Number 1 Region: 10-311
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000915
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number 2 Region: 1075-1151
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 993-1069
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Weak hits

Sequence:  CRE09257
Domain Number - Region: 858-920
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0834
Family Eukaryotic type KH-domain (KH-domain type I) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE09257   Protein: RP47758   Gene: WBGene00056801
Sequence length 1192
Comment RP47758 WBGene00056801 status:Predicted
Sequence
MTYNIDFSEPHWLIASYHSVGVISFFLNSLGIYLLAFQCKKLGNFRFYLVTYQSICFLTD
IHLTLLMQPVPLFPFLSAYATGLLADWFGVSLHYNALIAYSIIGLQFEFLLMSFIQKHQA
IGKILKTHILPKFSFLIFYIFCLITPLLVTLGINDIHDQKEKQLRYIAMFHPEYLQNFQQ
LSHFDFYIKNSTYVFMAAVVIIFLSLICIMLALIIMDIFRLMRALKLRISPGTFEKHKDA
IRSLVVQITTTIFCVSPTLLIVGSIVLELRNAQFLGSICLVLFSAHSSINIISLFLFFPP
FRKYASEYIPLNNNTEIITSDRQIFKNMDRDVEIDSFDDDCVIIEKPAPKTPEYIQLDSD
DDIPEANSKDHPDQTSSISTSNLSKMESKMNSRRNGDPLYYVDPFPSEEEETPNMCNFPT
SYLQRRFREHEELVKRLTEKNRLKHARLDAMEKLQAAEAANKEYEMSSSTSSQLYESWSP
SYSQSPDQTQQQKEVNEHSTVRSFSPREDAMASKRIEKSRHEAPVLESQEQLHHRQQSSG
SASFYGIKTNRDDVFDIREESSKVKTLQQFLASNKSRLPIGSRQSNAEITEDEQCDEEIR
IVFDRNLHLRENGKDTAFGKSPQPTLHIQQHAVRESEISEGHKKYRDRHASEVVYRRDSV
KSTDSHSTRYRHDSRRRDVEYQRHSQDSESSRTGRRGERRLQEDHSRYSSHNNRDRGSGF
RRTSEENHRLDGNRRARSPPIESTSQRPSVSELCRQFEGIRAGKRGIEEDDENSTQPLPK
RCLTELTEEQRELLIANGIPDLREIEAGTASYIKSDISVLSAKEIEELARLRAITEHARS
QRGTHPIPLNCTGYVDKYLDEITRRSGCRKMRIGRTKYSNRYRYVHIRGEAETIENARRE
LDEMCLEKLEDEYEYNVKHHRTNSYVYYCHYIPEKCIAKMRTQQEYREACRRAALNGVQL
SHQMHPSTEEDNPPMEMRGLACAIRRAKEDLNEHIQEILDQKTVFVPIPTDNYVIGALIG
TKGSVIRDIEMETKALVFINKEMGVAEIEGGEKSIEKAKKRIERIIEEQQKLKKITREME
ISTDFIRDVIGRQGLVIQRIRSISGAGIFIPRVSMTERVIVTITGTEEQIERAQMEIGLI
LDQINHNYRGRSPSSSQHSPDSHRSNRNIKRERIDVEQEQSYHRQHRHRHRY
Download sequence
Identical sequences E3LHT8
CRE09257 XP_003116656.1.11157 31234.CRE09257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]