SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE09647 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE09647
Domain Number 1 Region: 270-342
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000577
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE09647   Protein: RP31129   Gene: WBGene00085854
Sequence length 404
Comment RP31129 WBGene00085854 status:Partially_confirmed
Sequence
MDEATLLSSAPQEVYIPQKLKAFMSEPQGSALVAALESQFQCIISVINDFLSVKSSIPGM
QADLSQIENILRDVWQKRDIQLMIREAALNASCTHTCHTILPRAYCAVVFFFSSDIKRRS
RCNDMIIDHFTGKVTMFGTEQSVNTAREVMIECLTEHFGLLEIEIPITRRTARMGYNSNA
IEMTQNSFNPEVPPPQLPAVCHPPFLNNIFSISEPNAILTSTPAPGPTRDDSSLLPFDNH
LLFPSDFSVPPPQLRPVVEAPPKTNNVEKIKHWIPTAEVGKILGNRAAMKKQIEGQFNCV
ITVHTEVYSHFGMTSVEIMAQNKEQCRGARNAVMSLMSAYQEKAGGSSVNDSGVNSPVSP
MTTESPSTTPEKRGGRQYHRSSFRDQPKVMLALTPRKIAPAVTE
Download sequence
Identical sequences E3MX07
31234.CRE09647 XP_003099340.1.11157 CRE09647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]