SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE09883 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE09883
Domain Number 1 Region: 64-140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000441
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE09883   Protein: RP47119   Gene: WBGene00084367
Sequence length 173
Comment RP47119 WBGene00084367 status:Predicted
Sequence
MSPTNADLNKVKKEITRVKKNRPDSQRRRQMRRRQGKEGTKKQTPPHAQAQNSNKDPANK
KAHEGDGEILAIKVLIPSSAVAAIIGECGVVMNTLRKDHKCQIQISKNETYPGTLEQICI
MKGSLRNILAVIESIQEKIRMKCADQVGNDAFDHANTLRIVETNFLDIRCLRT
Download sequence
Identical sequences E3NLS7
XP_003090644.1.11157 31234.CRE09883 CRE09883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]