SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE10186 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE10186
Domain Number 1 Region: 121-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.17e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE10186   Protein: RP02317   Gene: WBGene00059457
Sequence length 252
Comment RP02317 WBGene00059457 status:Predicted
Sequence
MDNHASFFTPLQQKFVQILSNYEKDPKTLQIHEECDQMDVVTSYFKLLLLEKTRLLQYGQ
ASFAVHLIDEEIGRLFMAPISMADIGILEECGRKALRFTELGAHSSDSDDSMHSDEDEVT
LTESVRIPIETYPTYNFIGRIIGPRGMTAKQLEKDTGCRIMIRGSYSNKIYGNSAQKNHG
DGVQDAIDSPLRVIIETSGPRREATARITEALNVVNSLLVPPPDGRDELKRRQLVELAIM
NGTYRPTCPTHD
Download sequence
Identical sequences E3M6S0
31234.CRE10186 XP_003108326.1.11157 CRE10186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]