SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE10798 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE10798
Domain Number - Region: 116-161
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00987
Family Eukaryotic type KH-domain (KH-domain type I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE10798   Protein: RP49543   Gene: WBGene00083831
Sequence length 184
Comment RP49543 WBGene00083831 status:Predicted
Sequence
MVLAAVLSMLRYVAGSDDRDFVDRLHSYFTCNLLIGLSVLVSFKQFGGKPVECLVPDIFS
SSWEQYAENYCWASDTYYVPTNEPVAGLHIDEKRQRKISYYQWVPFFLLLEAACCQLPSS
LWKYLAGHSGKFCNVLLQKRCVKINFQRNSNINVCFKNSYFCVKTFLWGQHKVSKNRSVL
QSWN
Download sequence
Identical sequences E3NWM8
XP_003087193.1.11157 CRE10798 31234.CRE10798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]