SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE12762 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE12762
Domain Number 1 Region: 460-518
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000251
Family SAM (sterile alpha motif) domain 0.0085
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000462
Family Eukaryotic type KH-domain (KH-domain type I) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE12762   Protein: RP45186   Gene: WBGene00062523
Sequence length 558
Comment RP45186 WBGene00062523 locus:Cre-bcc-1.1 status:Predicted
Sequence
MKMTSCHIHFPDSNKYSESNKSDQVSISGTPMNVYEALKHLRVRYKFTVMTSQNVKFQTM
CPLTVYMKLPWYNPGSPDLRPLMSQMDLEFSVEQNIYTLAIKMTGSQDASVLFAIRLVLH
HFLLTEEYLNISTTVLAREELNYQLENIEEHRERLREVCNKNNVTIQTFPETQSISVVGP
PAGVLNVRKMLIGFANVTVQFDCNVMDIHYPVQQLEQERGLQIGCKRKNGDVMTITMKST
ESKLAEVLQSRELLLALPPTTYSCTDDYDPNPVMNISGPSLTPLQTEMASGVRVFLTPPI
ESPRSPDPEDSPLAASILKGAKDISKNSDIWKKKPKADRGEMLMKATQAIFDDTVLSSPR
YPTDLWSGYGFSSSLPADLLKGMLDLSTNDQATSSSLLMNHSQRGLCSVREEDEELSDFS
ASSTNYGMSRVFEQPSRNVFSASTSVFDSNSLPYDLQWDINYFTDPSMVLAQLGCSEYMI
QLRDQEIDMHAFLLLDEQNLKDIGVSTIGARKKIHHAILSGFLFCLVLAAREHNPHFHIT
MTTFTELRDSARLNGYAF
Download sequence
Identical sequences E3M7N6
CRE12762 31234.CRE12762 XP_003107881.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]