SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE14300 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE14300
Domain Number 1 Region: 382-453
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE14300   Protein: RP26988   Gene: WBGene00070973
Sequence length 461
Comment RP26988 WBGene00070973 status:Predicted
Sequence
MEETLRNAGAREKRALRRVAGSEETNAPQKETACKKKKVAPPLRVVGLPLSRRVVSGSDY
QVKSRLPSTSRAAETREKSAQMEKAANMNKKKPAPPPHSVITLESSESSSESDLEEEEEE
EEDSSETEMEDQDGNRAESTRPEHQGTSEPPLSASTIKFNFNAAPSFFSDSFEKRRHEES
VSREESKIAAANRMEKRRESSSRPIVKTMEAREKRRLQNLEKHLRMYGEISSDYHSACRQ
LEEDLRRRKTQGLDEEPEVIFDSRSSRRQGLLEGSRQQEKAVRTEENQGRKEESPEPEVI
FDSRSSNRPDSEIPGTSSRRHDARRQKHPEPEELLRRRLEYLGRRERIETITRYHNSIIR
CRREGRRHDARRSEIEKRQETDTKHKEMKIPANSILKIIGEEGANIKHIRSTFGVDITIL
RPHEPGGKTASVLMTGDPCKILMARKHIKSILGGRRINTES
Download sequence
Identical sequences E3NEX5
31234.CRE14300 CRE14300 XP_003093047.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]