SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE14906 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE14906
Domain Number 1 Region: 142-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000217
Family Eukaryotic type KH-domain (KH-domain type I) 0.0079
Further Details:      
 
Weak hits

Sequence:  CRE14906
Domain Number - Region: 100-156
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0327
Family Gametocyte protein Pfg27 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE14906   Protein: RP08485   Gene: WBGene00075275
Sequence length 368
Comment RP08485 WBGene00075275 status:Predicted
Sequence
MSKAAKPPRGEYEPDWADEPEEEKKTRKETAKMFGPQKDPEWWDINTFSKEDNPNGLLQE
SSFSSLFPKYREKYIKESWPLIEKALGEHFLKADLDLLEGTMCVRTTRKTWDPYIIMKAR
EVIKLLSRSVPYEQAIRVLEDEIYCEIIKISSMVRNKERFVKRRARLIGNDGATLKALEL
LTQCYVCVQGGTVCAVGPLSGLKQINQIVSDCMKNIHPIYNIKTMMIKRELSKNDELKDV
NWDQYLPNYRKKVQSASTTKEAKKKKAYKMKPKGEYTPFPPAPVMSKIDKQIESGEYFIR
ENERKLNKKRAKLEASAVKTVEKQKQKLKVYQAKEEAPREKQTKKRPTDAPIDLEKLKKK
AKLSKAAK
Download sequence
Identical sequences E3N1T6
XP_003097661.1.11157 31234.CRE14906 CRE14906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]