SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE16415 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE16415
Domain Number 1 Region: 107-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.01e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16415   Protein: RP24265   Gene: WBGene00071683
Sequence length 370
Comment RP24265 WBGene00071683 status:Predicted
Sequence
MSSTPTADSLADGVQHLLLAEKLNQLLTPPQTDYSAKSQKSTSNHSDSEKNVYIESLTEE
RDHLVQYSDEFNHALKLIEQEINRVREGEQPKEKEVTVGALATGSLLSEIVVVPVDLYPN
YNFVGRILGPRGTTAKQLESSTGCRVTILGRNKKDAGAAPADSAAPVDNGPLRVQISVPS
DAPDAAKRMEMGLNVVKALLVPPADGQDELKRQQLMVLANMNGTYRPRTTSSNTSHPFAG
SGDYGNQFQNLLPYGYRLPGKSQSPHSETKSDCYNPKCAILRSLMDQNNINTSIPKIEDV
LSVVHMYELMNRIRLANSSLLSRQEEVSKAQEIGNRMCSSIGVPRRPSATPAPTPTSTRR
LFNAKPRPQH
Download sequence
Identical sequences E3NC58
31234.CRE16415 CRE16415 XP_003094035.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]