SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE16465 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE16465
Domain Number - Region: 122-207
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.023
Family GntR ligand-binding domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16465   Protein: RP16232   Gene: WBGene00073015
Sequence length 310
Comment RP16232 WBGene00073015 status:Predicted
Sequence
MMKFLFIFLFLRVVSSDISLERNEQLIQAVAGFCTSSDGYDSGFCVDYAKLRRERATPNA
TVTTPEEIVNKTLSAETPAPVKAGPGEILFKEGNKTTLVDPNDTTDPDEELEGLTAKQIQ
DELRKIIQEELAKKAIQKTSPDDPACRNLRDEYDEVCFATPPLAAFQETKEFCLAFVKNC
QNSLLTNIFTNVKSFKIDFTAYCKKHRERFRYVCPDPLRFQSFAENAVDFCVRYQDRCPA
EPVPAEPVKFHRKDEGHIYTREIEFWCTRTKRTAYNYCTEPDLLRVYKYAMFCGMYKYAC
IDIYKRVIYG
Download sequence
Identical sequences E3NHD4
CRE16465 XP_003092192.1.11157 31234.CRE16465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]